Recombinant Human Cytochrome c oxidase subunit 7A-related protein, mitochondrial (COX7A2L) | CSB-EP005862HU

(No reviews yet) Write a Review
SKU:
CSB-EP005862HU
Availability:
13 - 23 Working Days
  • Recombinant Human Cytochrome c oxidase subunit 7A-related protein, mitochondrial (COX7A2L)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Human Cytochrome c oxidase subunit 7A-related protein, mitochondrial (COX7A2L) | CSB-EP005862HU | Cusabio

Alternative Name(s): COX7a-related protein Cytochrome c oxidase subunit VIIa-related protein EB1

Gene Names: COX7A2L

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-114aa

Sequence Info: Full Length

MW: 39.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in the regulation of oxidative phosphorylation and energy metabolism. Necessary for the assembly of mitochondrial respiratory supercomplex

Reference: "Isolation of estrogen-responsive genes with a CpG island library." Watanabe T., Inoue S., Hiroi H., Orimo A., Kawashima H., Muramatsu M. Mol. Cell. Biol. 18:442-449(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in the regulation of oxidative phosphorylation and energy metabolism (By similarity). Necessary for the assembly of mitochondrial respiratory supercomplex (By similarity).

Involvement in disease:

Subcellular Location: Mitochondrion inner membrane

Protein Families: Cytochrome c oxidase VIIa family

Tissue Specificity:

Paythway: Cardiacmusclecontraction

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O14548

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose