Cusabio Human Recombinants
Recombinant Human Cytochrome c oxidase subunit 7A-related protein, mitochondrial (COX7A2L) | CSB-EP005862HU
- SKU:
- CSB-EP005862HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Cytochrome c oxidase subunit 7A-related protein, mitochondrial (COX7A2L) | CSB-EP005862HU | Cusabio
Alternative Name(s): COX7a-related protein Cytochrome c oxidase subunit VIIa-related protein EB1
Gene Names: COX7A2L
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-114aa
Sequence Info: Full Length
MW: 39.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Involved in the regulation of oxidative phosphorylation and energy metabolism. Necessary for the assembly of mitochondrial respiratory supercomplex
Reference: "Isolation of estrogen-responsive genes with a CpG island library." Watanabe T., Inoue S., Hiroi H., Orimo A., Kawashima H., Muramatsu M. Mol. Cell. Biol. 18:442-449(1998)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Involved in the regulation of oxidative phosphorylation and energy metabolism (By similarity). Necessary for the assembly of mitochondrial respiratory supercomplex (By similarity).
Involvement in disease:
Subcellular Location: Mitochondrion inner membrane
Protein Families: Cytochrome c oxidase VIIa family
Tissue Specificity:
Paythway: Cardiacmusclecontraction
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: O14548
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM