Recombinant Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1) | CSB-EP005832HU

(No reviews yet) Write a Review
SKU:
CSB-EP005832HU
Availability:
3 - 7 Working Days
  • Recombinant Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1) | CSB-EP005832HU | Cusabio

Alternative Name(s): Cytochrome c oxidase polypeptide IVCytochrome c oxidase subunit IV isoform 1 ;COX IV-1

Gene Names: COX4I1

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 23-169aa

Sequence Info: Full Length of Mature Protein

MW: 33.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.

Reference: Isolation of a cDNA clone encoding subunit IV of human cytochrome c oxidase.Zeviani M., Nakagawa M., Herbert J., Lomax M.I., Grossman L.I., Sherbany A.A., Miranda A.F., Dimauro S., Schon E.A.Gene 55:205-217(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.

Involvement in disease:

Subcellular Location: Mitochondrion inner membrane

Protein Families: Cytochrome c oxidase IV family

Tissue Specificity: Ubiquitous.

Paythway: Cardiacmusclecontraction

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P13073

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose