Cusabio Human Recombinants
Recombinant Human 28S ribosomal protein S6, mitochondrial (MRPS6) | CSB-EP014937HU
- SKU:
- CSB-EP014937HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human 28S ribosomal protein S6, mitochondrial (MRPS6) | CSB-EP014937HU | Cusabio
Alternative Name(s): MRPS6; C21orf101; RPMS628S ribosomal protein S6; mitochondrial; MRP-S6; S6mt; Mitochondrial small ribosomal subunit protein bS6m
Gene Names: MRPS6
Research Areas: Others
Organism: Homo sapiens (Human)
AA Sequence: PRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-125aa
Sequence Info: Full Length
MW: 41.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance:
Reference: "Nineteen additional unpredicted transcripts from human chromosome 21." Reymond A., Camargo A.A., Deutsch S., Stevenson B.J., Parmigiani R.B., Ucla C., Bettoni F., Rossier C., Lyle R., Guipponi M., de Souza S., Iseli C., Jongeneel C.V., Bucher P., Simpson A.J.G., Antonarakis S.E. Genomics 79:824-832(2002)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location: Mitochondrion
Protein Families: Bacterial ribosomal protein bS6 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P82932
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM