Recombinant Human 39S ribosomal protein L20, mitochondrial (MRPL20) | CSB-EP863153HU

(No reviews yet) Write a Review
SKU:
CSB-EP863153HU
Availability:
13 - 23 Working Days
  • Recombinant Human 39S ribosomal protein L20, mitochondrial (MRPL20)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human 39S ribosomal protein L20, mitochondrial (MRPL20) | CSB-EP863153HU | Cusabio

Alternative Name(s): MRPL20; 39S ribosomal protein L20; mitochondrial; L20mt; MRP-L20; Mitochondrial large ribosomal subunit protein bL20m

Gene Names: MRPL20

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: VIRAFVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 46-149aa

Sequence Info: Full Length of Mature Protein

MW: 27.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: Structural compensation for the deficit of rRNA with proteins in the mammalian mitochondrial ribosome. Systematic analysis of protein components of the large ribosomal subunit from mammalian mitochondria.Suzuki T., Terasaki M., Takemoto-Hori C., Hanada T., Ueda T., Wada A., Watanabe K.J. Biol. Chem. 276:21724-21736(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Mitochondrion

Protein Families: Bacterial ribosomal protein bL20 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9BYC9

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose