null

Recombinant Human 28S ribosomal protein S16, mitochondrial (MRPS16) | CSB-EP897105HU

(No reviews yet) Write a Review
SKU:
CSB-EP897105HU
Availability:
13 - 23 Working Days
  • Recombinant Human 28S ribosomal protein S16, mitochondrial (MRPS16)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,702.00
Frequently bought together:

Description

Recombinant Human 28S ribosomal protein S16, mitochondrial (MRPS16) | CSB-EP897105HU | Cusabio

Alternative Name(s): 28S ribosomal protein S16; 28S ribosomal protein S16 mitochondrial; CGI-132; COXPD2; mitochondrial; Mitochondrial ribosomal protein S16; MRP-S16; mrps16; RPMS16; RT16_HUMAN; S16mt

Gene Names: MRPS16

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: VAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-137aa

Sequence Info: Full Length

MW: 38.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Proteomic analysis of the mammalian mitochondrial ribosome. Identification of protein components in the 28S small subunit." Suzuki T., Terasaki M., Takemoto-Hori C., Hanada T., Ueda T., Wada A., Watanabe K. J. Biol. Chem. 276:33181-33195(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease: Combined oxidative phosphorylation deficiency 2 (COXPD2)

Subcellular Location: Mitochondrion

Protein Families: Bacterial ribosomal protein bS16 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9Y3D3

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose