null

Recombinant Human 28S ribosomal protein S6, mitochondrial (MRPS6) | CSB-EP014937HU

(No reviews yet) Write a Review
SKU:
CSB-EP014937HU
Availability:
13 - 23 Working Days
  • Recombinant Human 28S ribosomal protein S6, mitochondrial (MRPS6)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,702.00
Frequently bought together:

Description

Recombinant Human 28S ribosomal protein S6, mitochondrial (MRPS6) | CSB-EP014937HU | Cusabio

Alternative Name(s): MRPS6; C21orf101; RPMS628S ribosomal protein S6; mitochondrial; MRP-S6; S6mt; Mitochondrial small ribosomal subunit protein bS6m

Gene Names: MRPS6

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: PRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-125aa

Sequence Info: Full Length

MW: 41.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Nineteen additional unpredicted transcripts from human chromosome 21." Reymond A., Camargo A.A., Deutsch S., Stevenson B.J., Parmigiani R.B., Ucla C., Bettoni F., Rossier C., Lyle R., Guipponi M., de Souza S., Iseli C., Jongeneel C.V., Bucher P., Simpson A.J.G., Antonarakis S.E. Genomics 79:824-832(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Mitochondrion

Protein Families: Bacterial ribosomal protein bS6 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P82932

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose