Recombinant Human 28S ribosomal protein S22, mitochondrial (MRPS22) | CSB-EP014908HU

(No reviews yet) Write a Review
SKU:
CSB-EP014908HU
Availability:
13 - 23 Working Days
  • Recombinant Human 28S ribosomal protein S22, mitochondrial (MRPS22)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $2,042.40

Description

Recombinant Human 28S ribosomal protein S22, mitochondrial (MRPS22) | CSB-EP014908HU | Cusabio

Alternative Name(s): 28S ribosomal protein S22; C3orf5; COXPD5; GIBT; GK002; mitochondrial; Mitochondrial ribosomal protein S22; MRP-S22; MRPS22; RPM S22; RPMS22; RT22_HUMAN; S22mt

Gene Names: MRPS22

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQEALSRHSAAS

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-360aa

Sequence Info: Full Length

MW: 68.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "A proteomics approach to the identification of mammalian mitochondrial small subunit ribosomal proteins." Koc E.C., Burkhart W., Blackburn K., Moseley A., Koc H., Spremulli L.L. J. Biol. Chem. 275:32585-32591(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease: Combined oxidative phosphorylation deficiency 5 (COXPD5)

Subcellular Location: Mitochondrion

Protein Families: Mitochondrion-specific ribosomal protein mS22 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P82650

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose