Recombinant Bacillus subtilis Penicillin-binding protein 4 (pbpE) | CSB-EP333755BRJ

(No reviews yet) Write a Review
SKU:
CSB-EP333755BRJ
Availability:
3 - 7 Working Days
  • Recombinant Bacillus subtilis Penicillin-binding protein 4 (pbpE)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Bacillus subtilis Penicillin-binding protein 4 (pbpE) | CSB-EP333755BRJ | Cusabio

Alternative Name(s): PBP 4* Alternative name(s): PBP 4A Penicillin-binding protein E

Gene Names: pbpE

Research Areas: Microbiology

Organism: Bacillus subtilis (strain 168)

AA Sequence: MKQNKRKHLQTLFETLGEKHQFNGTVLAAEGGDILYHHSFGYAEMTEKRPLKTNSLFELASLSKPFTALGIILLEEKGILGYEDKVDRWLPGFPYQGVTIRHLLNHTSGLPDYMGWFFANWDSHKIAVNQDIVDMLMNEGLSGYFEPNEGWMYSNTGYVLLAVIIEKASGMSYADFIKTSIFLPAGMNETRVYNRRLSPERIDHYAYGYVYDVHSETYVLPDELEETNYVVYLDGIQGDGTVNSVTSDLFRFDQALYQDDFISKASKESAFSPVRLNNGETIDYGFGWVLQNSPEKGRIVSHSGGWPGYSTMMIRYIDHRKTLIYLSNKEEDTEYEQAILKAAEHILFGQPYDVPERPADKKKKAIDTAIYSRYVGSYLLQDGTAAQVTTENERLYLEIAGQLRLELFPSSETRFFLRALSVEVEFTLGEDAAKSFILYEDGSEEEAVRTK

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-451aa

Sequence Info: Full Length

MW: 67.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Probably involved in peptidoglycan modification during cortex synthesis.

Reference: "The complete genome sequence of the Gram-positive bacterium Bacillus subtilis."Kunst F., Ogasawara N., Moszer I., Albertini A.M., Alloni G., Azevedo V., Bertero M.G., Bessieres P., Bolotin A., Borchert S., Borriss R., Boursier L., Brans A., Braun M., Brignell S.C., Bron S., Brouillet S., Bruschi C.V. Danchin A.Nature 390:249-256(1997).

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Probably involved in peptidoglycan modification during cortex synthesis.

Involvement in disease:

Subcellular Location: Cell membrane, Peripheral membrane protein

Protein Families: Beta-lactamase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P32959

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose