Cusabio Bacillus subtilis Recombinants
Recombinant Bacillus subtilis Penicillin-binding protein 3 (pbpC), partial | CSB-EP331705BRJ
- SKU:
- CSB-EP331705BRJ
- Availability:
- 3 - 7 Working Days
Description
Recombinant Bacillus subtilis Penicillin-binding protein 3 (pbpC), partial | CSB-EP331705BRJ | Cusabio
Alternative Name(s): PBP 3 Alternative name(s): PSPB20 Penicillin-binding protein C
Gene Names: pbpC
Research Areas: Microbiology
Organism: Bacillus subtilis (strain 168)
AA Sequence: CSKTDSPEDRMEAFVKQWNDQQFDDMYQSLTKDVKKEISKKDFVNRYKAIYEQAGVKNLKVTAGEVDKDDQDNKTMKHIPYKVSMNTNAGKVSFKNTAVLKLEKTDDEESWNIDWDPSFIFKQLADDKTVQIMSIEPKRGQIYDKNGKGLAVNTDVPEIGIVPGELGDKKEKVIKELAKKLDLTEDDIKKKLDQGWVKDDSFVPLKKVKPDQEKLVSEAT
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 21-240aa
Sequence Info: Partial
MW: 29.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance:
Reference: "The complete genome sequence of the Gram-positive bacterium Bacillus subtilis."Kunst F., Ogasawara N., Moszer I., Albertini A.M., Alloni G., Azevedo V., Bertero M.G., Bessieres P., Bolotin A., Borchert S., Borriss R., Boursier L., Brans A., Braun M., Brignell S.C., Bron S., Brouillet S., Bruschi C.V. Danchin A.Nature 390:249-256(1997)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location: Cell membrane, Single-pass membrane protein
Protein Families: Transpeptidase family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P42971
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A