- Home
- Research Recombinants
- Recombinant Bacillus subtilis Penicillin-binding protein 4 (pbpE) | CSB-EP333755BRJ
Cusabio Bacillus subtilis Recombinants
Recombinant Bacillus subtilis Penicillin-binding protein 4 (pbpE) | CSB-EP333755BRJ
- SKU:
- CSB-EP333755BRJ
- UPC:
- MPN:
- Availability:
- 3 - 7 Working Days
Description
Recombinant Bacillus subtilis Penicillin-binding protein 4 (pbpE) | CSB-EP333755BRJ | Cusabio
Alternative Name(s): PBP 4* Alternative name(s): PBP 4A Penicillin-binding protein E
Gene Names: pbpE
Research Areas: Microbiology
Organism: Bacillus subtilis (strain 168)
AA Sequence: MKQNKRKHLQTLFETLGEKHQFNGTVLAAEGGDILYHHSFGYAEMTEKRPLKTNSLFELASLSKPFTALGIILLEEKGILGYEDKVDRWLPGFPYQGVTIRHLLNHTSGLPDYMGWFFANWDSHKIAVNQDIVDMLMNEGLSGYFEPNEGWMYSNTGYVLLAVIIEKASGMSYADFIKTSIFLPAGMNETRVYNRRLSPERIDHYAYGYVYDVHSETYVLPDELEETNYVVYLDGIQGDGTVNSVTSDLFRFDQALYQDDFISKASKESAFSPVRLNNGETIDYGFGWVLQNSPEKGRIVSHSGGWPGYSTMMIRYIDHRKTLIYLSNKEEDTEYEQAILKAAEHILFGQPYDVPERPADKKKKAIDTAIYSRYVGSYLLQDGTAAQVTTENERLYLEIAGQLRLELFPSSETRFFLRALSVEVEFTLGEDAAKSFILYEDGSEEEAVRTK
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-451aa
Sequence Info: Full Length
MW: 67.4 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Probably involved in peptidoglycan modification during cortex synthesis.
Reference: "The complete genome sequence of the Gram-positive bacterium Bacillus subtilis."Kunst F., Ogasawara N., Moszer I., Albertini A.M., Alloni G., Azevedo V., Bertero M.G., Bessieres P., Bolotin A., Borchert S., Borriss R., Boursier L., Brans A., Braun M., Brignell S.C., Bron S., Brouillet S., Bruschi C.V. Danchin A.Nature 390:249-256(1997).
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Probably involved in peptidoglycan modification during cortex synthesis.
Involvement in disease:
Subcellular Location: Cell membrane, Peripheral membrane protein
Protein Families: Beta-lactamase family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P32959
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A
Related Products

Recombinant Bacillus subtilis Uncharacterized protein yuaB (yuaB) | CSB-EP300296BRJ
Cusabio Bacillus subtilis Recombinants

Recombinant Bacillus subtilis Penicillin-binding protein 1A/1B (ponA), partial | CSB-EP331077BRJ
Cusabio Bacillus subtilis Recombinants

Recombinant Bacillus subtilis Penicillin-binding protein 3 (pbpC), partial | CSB-EP331705BRJ
Cusabio Bacillus subtilis Recombinants

Recombinant Bacillus subtilis Penicillin-binding protein 4 (pbpD), partial | CSB-EP334764BRJ
Cusabio Bacillus subtilis Recombinants

Recombinant Bacillus subtilis Phosphocarrier protein HPr (ptsH) | CSB-EP362538BRJ
Cusabio Bacillus subtilis Recombinants
Customers Also Viewed

Recombinant Bacillus subtilis Penicillin-binding protein 4 (pbpD), partial | CSB-EP334764BRJ
Cusabio Bacillus subtilis Recombinants

pbpE Antibody | CSB-PA333755HA01BRJ
Cusabio Polyclonal Antibodies

pbpE Antibody, FITC conjugated | CSB-PA333755HC01BRJ
Cusabio Polyclonal Antibodies

pbpE Antibody, HRP conjugated | CSB-PA333755HB01BRJ
Cusabio Polyclonal Antibodies

Recombinant Bacillus subtilis Phosphocarrier protein HPr (ptsH) | CSB-EP362538BRJ
Cusabio Bacillus subtilis Recombinants

Recombinant Bacillus subtilis Penicillin-binding protein 3 (pbpC), partial | CSB-EP331705BRJ
Cusabio Bacillus subtilis Recombinants

Recombinant Bacillus subtilis Penicillin-binding protein 1A/1B (ponA), partial | CSB-EP331077BRJ
Cusabio Bacillus subtilis Recombinants

Recombinant Bacillus subtilis Uncharacterized protein yuaB (yuaB) | CSB-EP300296BRJ
Cusabio Bacillus subtilis Recombinants

pbpE Antibody, Biotin conjugated | CSB-PA333755HD01BRJ
Cusabio Polyclonal Antibodies

mpt64 Antibody, HRP conjugated | CSB-PA14949B0Rb
Cusabio Polyclonal Antibodies

TESC Antibody | CSB-PA023393GA01HU
Cusabio Polyclonal Antibodies

CLTA Antibody | CSB-PA005591GA01HU
Cusabio Polyclonal Antibodies

Human Dickkopf-related protein 4 (DKK4) ELISA kit | CSB-EL006923HU
Cusabio Elisa

Human Intestinal-type alkaline phosphatase, ALPI ELISA Kit | CSB-E09709h
Cusabio Elisa

Human myelin basic protein (MBP) antibody ELISA Kit | CSB-E04787h
Cusabio Elisa

Mouse Beta-Endorphin, β-EP ELISA Kit | CSB-E06827m
Cusabio Elisa

Human Sortilin-related receptor (SORL1) ELISA kit | CSB-EL022411HU
Cusabio Elisa

Mouse Regenerating islet-derived protein 3-alpha (REG3A) ELISA kit | CSB-EL019548MO
Cusabio Elisa

Human Regenerating islet-derived protein 3-alpha (REG3A) ELISA kit | CSB-EL019548HU
Cusabio Elisa

Rat Prostaglandin-H2 D-isomerase (PTGDS) ELISA kit | CSB-EL018969RA
Cusabio Elisa

Human eosinophil granule major basic protein (EMBP/MBP) ELISA Kit | CSB-E17578h
Cusabio Elisa

Mouse Ovalbumin Specific IgG (OVA sIgG) ELISA Kit | CSB-E14990m
Cusabio Elisa

Rat myelin basic protein, MBP ELISA Kit | CSB-E08284r
Cusabio Elisa

Mouse Lysyl oxidase homolog 2 (LOXL2) ELISA kit | CSB-EL013041MO
Cusabio Elisa

Human Lysyl oxidase homolog 1 (LOXL1) ELISA kit | CSB-EL013040HU
Cusabio Elisa

Mouse D-Lactate Dehydrogenase, D-LDH ELISA Kit | CSB-E11723m
Cusabio Elisa

Rat growth differentiation factor 15 (GDF15) ELISA Kit | CSB-E16317r
Cusabio Elisa

Human coagulation factor Ⅶ, FⅦ ELISA Kit | CSB-E12909h
Cusabio Elisa

Human coagulation factor Ⅴ (FⅤ) ELISA Kit | CSB-E14302h
Cusabio Elisa

Human Coagulation factor XI (F11) ELISA kit | CSB-EL007916HU
Cusabio Elisa

Human Dickkopf-related protein 2 (DKK2) ELISA kit | CSB-EL006921HU
Cusabio Elisa

Human dopamine-β-hydroxylase, DBH ELISA Kit | CSB-E09653h
Cusabio Elisa

Human Placental alkaline phosphatase, PLAP ELISA Kit | CSB-E09160h
Cusabio Elisa

Rat Agouti Related Protein, AGRP ELISA Kit | CSB-E13570r
Cusabio Elisa

Human Actin, cytoplasmic 2 (ACTG1) ELISA kit | CSB-EL001222HU
Cusabio Elisa

Human Follistatin Like Protein 1 (FSTL1) ELISA Kit | CSB-E13516h
Cusabio Elisa

Human β-hexosaminidase A, β-Hex A ELISA Kit | CSB-E09462h
Cusabio Elisa

Rat Thyroid-Peroxidase, TPO ELISA Kit | CSB-E08352r
Cusabio Elisa

Human Sortilin (SORT1) ELISA kit | CSB-EL022412HU
Cusabio Elisa

Rat Protein S100-A6 (S100A6) ELISA kit | CSB-EL020634RA
Cusabio Elisa

Rat Protein S100-A1 (S100A1) ELISA kit | CSB-EL020622RA
Cusabio Elisa

Mouse prostate specific antigen, PSA ELISA Kit | CSB-E08276m
Cusabio Elisa

Human periostin/osteoblast specific factor 2 (POSTN) ELISA kit | CSB-E16444h
Cusabio Elisa

Mouse Bone-specific alkaline phosphatase (BALP) ELISA kit | CSB-E11914m
Cusabio Elisa

Human Nesfatin-1 ELISA Kit | CSB-E15050h
Cusabio Elisa

Mouse myelin basic protein, MBP ELISA Kit | CSB-E08285m
Cusabio Elisa

Human monoamine oxidase, MAO ELISA Kit | CSB-E10144h
Cusabio Elisa

Human Lysyl oxidase homolog 3 (LOXL3) ELISA kit | CSB-EL013042HU
Cusabio Elisa

Pig Interleukin 6, IL-6 ELISA Kit | CSB-E06786p
Cusabio Elisa

Pig Immunoglobulin A, IgA ELISA Kit | CSB-E13234p
Cusabio Elisa