null

Recombinant Bacillus subtilis Penicillin-binding protein 4 (pbpD), partial | CSB-EP334764BRJ

(No reviews yet) Write a Review
SKU:
CSB-EP334764BRJ
Availability:
3 - 7 Working Days
  • Recombinant Bacillus subtilis Penicillin-binding protein 4 (pbpD), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00
Frequently bought together:

Description

Recombinant Bacillus subtilis Penicillin-binding protein 4 (pbpD), partial | CSB-EP334764BRJ | Cusabio

Alternative Name(s): pbpD; BSU31490; Penicillin-binding protein 4; PBP 4) [Includes: Penicillin-insensitive transglycosylase; EC 2.4.1.129; Peptidoglycan TGase); Penicillin-sensitive transpeptidase; EC 3.4.16.4; DD-transpeptidase)]

Gene Names: pbpD

Research Areas: Others

Organism: Bacillus subtilis (strain 168)

AA Sequence: PNNPTLYDPLKHFDYTKSRQERLLKGLKDAGVITDKELKKAVKQKIKLDVEKREDKYPDYVSYVNDEFTQLVSESEGFDKRLQKASGKQKEKIENELSARVSTLMKDGVKIYTALDPYMQNQVVAQMNSKLPYADVQGGAAVINHQTHQIIALSGGKNYQKYDFNRAYQAYRQPGSSIKPLLDYGPYIEQTGATTSSTIDASKFCSKDYCPQNYNNRTYGTVTLDTAFKNSYNTPAIR

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 213-450aa

Sequence Info: Partial

MW: 43 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "From a consortium sequence to a unified sequence: the Bacillus subtilis 168 reference genome a decade later." Barbe V., Cruveiller S., Kunst F., Lenoble P., Meurice G., Sekowska A., Vallenet D., Wang T., Moszer I., Medigue C., Danchin A. Microbiology 155:1758-1775(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Cell membrane, Peripheral membrane protein

Protein Families: Glycosyltransferase 51 family; Transpeptidase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P40750

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose