E.coli Recombinant

Recombinant Synechococcus sp. Deoxyribodipyrimidine photo-lyase (phr) | CSB-EP361494FPZ | CusabioAlternative Name(s): DNA photolyase Photoreactivating enzymeGene Names: phrResearch Areas: Epigenetics and Nuclear SignalingOrganism: Synechococcus sp...

Recombinant Avian infectious bronchitis virus Non-structural protein 3b (3b) | CSB-EP361472ARW | CusabioAlternative Name(s): ns3b;Accessory protein 3bGene Names: 3bResearch Areas: othersOrganism: Avian infectious bronchitis virus (strain M41) (IBV)AA...

Recombinant Mouse Major urinary protein 11 (Mup11) | CSB-EP361419MOb0 | CusabioAlternative Name(s): Mup9Gene Names: Mup11Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Major urinary proteins 11 and 8 (Mup11) | CSB-EP361419MO | CusabioAlternative Name(s): MUP11 and MUP8Gene Names: Mup11Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Plasmodium falciparum Merozoite surface protein 1 (MSP-1), partial | CSB-EP361416EWT | CusabioAlternative Name(s): Merozoite surface antigens PMMSA p190Gene Names: MSP-1Research Areas: OthersOrganism: Plasmodium falciparum (isolate K1 /...

Recombinant Mouse Serum amyloid A-3 protein (Saa3) | CSB-EP361411MO | CusabioAlternative Name(s): Saa3; Serum amyloid A-3 proteinGene Names: Saa3Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Triticum aestivum Alpha/beta-gliadin A-II | CSB-EP361350TQN | CusabioAlternative Name(s): ProlaminGene Names: N/AResearch Areas: Cell BiologyOrganism: Triticum aestivum (Wheat)AA Sequence:...

Recombinant Zea mays (Maize) Sucrose synthase 1 (SH-1), partial | CSB-EP361346ZAX | CusabioAlternative Name(s): Shrunken-1 Sucrose-UDP glucosyltransferase 1Gene Names: SH-1Research Areas: OthersOrganism: Zea mays (Maize)AA Sequence:...

Recombinant Influenza B virus Nucleoprotein (NP) | CSB-EP361330IJK | CusabioAlternative Name(s): Nucleocapsid protein ;Protein NGene Names: NPResearch Areas: OthersOrganism: Influenza B virus (strain B/Lee/1940)AA Sequence:...

Recombinant Human immunodeficiency virus type 1 group M subtype B Envelope glycoprotein gp160 (env), partial | CSB-EP361302HKP | CusabioAlternative Name(s): Env polyproteinGene Names: envResearch Areas: OthersOrganism: Human immunodeficiency virus type 1...

Recombinant Enterobacteria phage T4 Recombination and repair protein (UVSX) | CSB-EP361289EDZ | CusabioAlternative Name(s): UVSX,Recombination and repair proteinGene Names: UVSXResearch Areas: OthersOrganism: Enterobacteria phage T4 (Bacteriophage T4)AA...

Recombinant Rotavirus A Outer capsid glycoprotein VP7 | CSB-EP361283RIV | CusabioAlternative Name(s): Outer capsid glycoprotein VP7Gene Names: N/AResearch Areas: OthersOrganism: Rotavirus A (strain RVA/Cow/United States/NCDV-Lincoln/1969/G6P6[1]) (RV-A)...

Recombinant Human HLA class II histocompatibility antigen, DRB1-1 beta chain (HLA-DRB1), partial | CSB-EP361230HU | CusabioAlternative Name(s): MHC class II antigen DRB1*1Gene Names: HLA-DRB1Research Areas: ImmunologyOrganism: Homo sapiens (Human) AA...

Recombinant Escherichia coli Type-1 fimbrial protein, A chain (fimA) | CSB-EP361210ENV | CusabioAlternative Name(s): Type-1A pilinGene Names: fimAResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Human papillomavirus type 11 Protein E6 (E6) | CSB-EP361193HMG | CusabioAlternative Name(s): Protein E6Gene Names: E6Research Areas: CancerOrganism: Human papillomavirus type 11AA Sequence:...

Recombinant Human papillomavirus type 11 Regulatory protein E2 (E2) | CSB-EP361192HMG | CusabioAlternative Name(s): Gene Names: E2Research Areas: Epigenetics and Nuclear SignalingOrganism: Human papillomavirus type 11AA Sequence:...

Recombinant SaccharoMyces cerevisiae Site-specific recombinase Flp (FLP1) | CSB-EP361171SVG | CusabioAlternative Name(s): Protein AbleGene Names: FLP1Research Areas: OthersOrganism: SaccharoMyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)AA...

Recombinant Escherichia phage lambda Capsid decoration protein (D) | CSB-EP361132FSFe3 | CusabioAlternative Name(s): Capsid decoration protein(Auxiliary protein D)(Gene product D)(gpD)(Major capsid protein D)Gene Names: DResearch Areas:...

Recombinant Escherichia phage lambda Capsid decoration protein (D), partial | CSB-EP361132FSF1e3 | CusabioAlternative Name(s): Auxiliary protein D Gene product D Major capsid protein DGene Names: DResearch Areas: CardiovascularOrganism: Escherichia phage...

Recombinant Escherichia phage lambda Capsid decoration protein (D), partial | CSB-EP361132FSF1 | CusabioAlternative Name(s): Auxiliary protein D Gene product D Major capsid protein DGene Names: DResearch Areas: CardiovascularOrganism: Escherichia phage...

Recombinant Escherichia phage lambda Capsid decoration protein (D) | CSB-EP361132FSF | CusabioAlternative Name(s): Auxiliary protein D Gene product D Major capsid protein DGene Names: DResearch Areas: CardiovascularOrganism: Escherichia phage lambda...

Recombinant Vesicular stomatitis Indiana virus Nucleoprotein (N) | CSB-EP361079VBJ | CusabioAlternative Name(s): Nucleocapsid proteinGene Names: NResearch Areas: MicrobiologyOrganism: Vesicular stomatitis Indiana virus (strain San Juan) (VSIV)AA...

Recombinant Human T-cell leukemia virus 1 Protein Tax-1 (tax) | CSB-EP361045HQJ | CusabioAlternative Name(s): Protein X-LOR (Protein PX) (Trans-activating transcriptional regulatory protein of HTLV-1)Gene Names: taxResearch Areas: CancerOrganism: Human...

Recombinant Human T-cell leukemia virus 1 Envelope glycoprotein gp62 (env), partial | CSB-EP361037HQJa2 | CusabioAlternative Name(s): Env polyproteinGene Names: envResearch Areas: MetabolismOrganism: Human T-cell leukemia virus 1 (strain Japan ATK-1...

Recombinant Human adenovirus C serotype 5 Protease (L3) | CSB-EP361000HILb1 | CusabioAlternative Name(s): Adenain Adenovirus proteaseGene Names: L3Research Areas: OthersOrganism: Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)AA Sequence:...

Recombinant Epstein-Barr virus Envelope glycoprotein GP350 (BLLF1), partial | CSB-EP360986EFA | CusabioAlternative Name(s): Membrane antigen Short name: MAGene Names: BLLF1Research Areas: OthersOrganism: Epstein-Barr virus (strain B95-8) (HHV-4) (Human...

Recombinant Human herpesvirus 1 ICP47 protein (US12) | CSB-EP360979HWY | CusabioAlternative Name(s): Immediate-early protein IE12 (Immediate-early-5) (Infected cell protein 47) (US12 protein) (Vmw12)Gene Names: US12Research Areas: OthersOrganism: Human...

Recombinant BK polyomavirus Minor capsid protein VP2 | CSB-EP360956BGYb0 | CusabioAlternative Name(s): Minor capsid protein VP2; Minor structural protein VP2Gene Names: N/AResearch Areas: OthersOrganism: BK polyomavirus (BKPyV) (Human polyomavirus 1)AA...

Recombinant BK polyomavirus Minor capsid protein VP2 | CSB-EP360956BGYa0 | CusabioAlternative Name(s): Minor capsid protein VP2; Minor structural protein VP2Gene Names: N/AResearch Areas: OthersOrganism: BK polyomavirus (BKPyV) (Human polyomavirus 1)AA...

Recombinant BK polyomavirus Minor capsid protein VP2 | CSB-EP360956BGY | CusabioAlternative Name(s): Minor capsid protein VP2; Minor structural protein VP2Gene Names: N/AResearch Areas: OthersOrganism: BK polyomavirus (BKPyV) (Human polyomavirus 1)AA...

Recombinant BK polyomavirus Major capsid protein VP1 | CSB-EP360953BGYb1 | CusabioAlternative Name(s): Major structural protein VP1Gene Names: N/AResearch Areas: OthersOrganism: BK polyomavirus (BKPyV) (Human polyomavirus 1)AA Sequence:...

Recombinant BK polyomavirus Major capsid protein VP1 | CSB-EP360953BGY | CusabioAlternative Name(s): Major structural protein VP1Gene Names: N/AResearch Areas: MicrobiologyOrganism: BK polyomavirus (BKPyV)AA Sequence:...

Recombinant Staphylococcus aureus Replication initiation protein (repD) | CSB-EP360946FKZ | CusabioAlternative Name(s): repD; Replication initiation proteinGene Names: repDResearch Areas: OthersOrganism: Staphylococcus aureusAA Sequence:...

Recombinant Escherichia coli DNA helicase II (uvrD) | CSB-EP360936ENV | CusabioAlternative Name(s): mutU, pdeB, rad, recLGene Names: uvrDResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Escherichia coli Colicin-E1 (cea), partial | CSB-EP360926ENL1 | CusabioAlternative Name(s): cea; Colicin-E1Gene Names: ceaResearch Areas: Tags & Cell MarkersOrganism: Escherichia coliAA Sequence:...

Recombinant Triticum monococcum Omega-gliadin, partial | CSB-EP360898TKR | CusabioAlternative Name(s): Omega-gliadin; FragmentGene Names: N/AResearch Areas: OthersOrganism: Triticum monococcum (Einkorn wheat) (Crithodium monococcum)AA Sequence:...

Recombinant Rat Alpha-1-acid glycoprotein (Orm1) | CSB-EP360882RAa0 | CusabioAlternative Name(s): Orosomucoid ?OMD?Gene Names: Orm1Research Areas: CardiovascularOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Alpha-1-acid glycoprotein (Orm1) | CSB-EP360882RA | CusabioAlternative Name(s): Orosomucoid (OMD)Gene Names: Orm1Research Areas: CardiovascularOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Mouse Major urinary protein 6 (Mup6) | CSB-EP360881MO | CusabioAlternative Name(s): Alpha-2U-globulin Group 1, BS6 Allergen: Mus m 1Gene Names: Mup6Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Escherichia coli 30S ribosomal protein S7 (rpsG) | CSB-EP360849ENV | CusabioAlternative Name(s): rpsG; b3341; JW3303; 30S ribosomal protein S7; Small ribosomal subunit protein uS7Gene Names: rpsGResearch Areas: OthersOrganism: Escherichia...

Recombinant Mouse Hemoglobin subunit beta-2 (Hbb-b2) | CSB-EP360812MO | CusabioAlternative Name(s): Beta-2-globinHemoglobin beta-2 chainHemoglobin beta-minor chainGene Names: Hbb-b2Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human HLA class II histocompatibility antigen, DR alpha chain (HLA-DRA), partial | CSB-EP360793HU1 | CusabioAlternative Name(s): MHC class II antigen DRAGene Names: HLA-DRAResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human HLA class II histocompatibility antigen, DR alpha chain (HLA-DRA) | CSB-EP360793HU | CusabioAlternative Name(s): MHC class II antigen DRA HLA-DRA1Gene Names: HLA-DRAResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interferon alpha-2 (IFNA2) | CSB-EP360706HU | CusabioAlternative Name(s): Interferon alpha-A ;LeIF AGene Names: IFNA2Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Escherichia coli Heat-stable enterotoxin ST-2 | CSB-EP360705ENL | CusabioAlternative Name(s): Gene Names: N/AResearch Areas: OthersOrganism: Escherichia coliAA Sequence: NTFYCCELCCNPACAGCYSource: E.coliTag Info: Tag-FreeExpression Region:...

Recombinant Vibrio cholerae serotype O1 Cholera enterotoxin subunit B (ctxB) | CSB-EP360704VEX | CusabioAlternative Name(s): Cholera enterotoxin B chain Cholera enterotoxin gamma chain CholeragenoidGene Names: ctxBResearch Areas: MicrobiologyOrganism:...

Recombinant Staphylococcus aureus Enterotoxin type B (entB) | CSB-EP360703FKZ | CusabioAlternative Name(s): SEBGene Names: entBResearch Areas: OthersOrganism: Staphylococcus aureusAA Sequence:...

Recombinant Schmidtea mediterranea Activin 2, partial | CSB-EP3606GOQ1 | CusabioAlternative Name(s): Activin 2(Fragment)Gene Names: N/AResearch Areas: OthersOrganism: Schmidtea mediterranea (Freshwater planarian flatworm)AA Sequence:...

Recombinant Mouse Insulin-2 (Ins2) | CSB-EP360644MO | CusabioAlternative Name(s): Ins-2Gene Names: Ins2Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Glycine max Bowman-Birk type proteinase inhibitor D-II | CSB-EP360616GGV | CusabioAlternative Name(s): IVGene Names: N/AResearch Areas: OthersOrganism: Glycine max (Soybean) (Glycine hispida)AA Sequence:...

Recombinant Dog Double-headed protease inhibitor, submandibular gland | CSB-EP360611DO | CusabioAlternative Name(s): /Gene Names: N/AResearch Areas: OthersOrganism: Canis lupus familiaris (Dog) (Canis familiaris)AA Sequence:...

Recombinant Escherichia coli Deoxyribodipyrimidine photo-lyase (phrB) | CSB-EP360595ENV | CusabioAlternative Name(s): DNA photolyase Photoreactivating enzymeGene Names: phrBResearch Areas: Epigenetics and Nuclear SignalingOrganism: Escherichia coli...

Recombinant Anas platyrhynchos Lysozyme C-1 | CSB-EP360572BZD | CusabioAlternative Name(s): 1,4-beta-N-acetylmuramidase CGene Names: N/AResearch Areas: OthersOrganism: Anas platyrhynchos (Mallard) (Anas boschas)AA Sequence:...

Recombinant Saccharomyces cerevisiae GTP-binding protein YPT1 (YPT1) | CSB-EP360492SVG | CusabioAlternative Name(s): Protein YP2 Rab GTPase YPT1 Transport GTPase YPT1Gene Names: YPT1Research Areas: OthersOrganism: Saccharomyces cerevisiae (strain ATCC...

Recombinant Escherichia coli Beta-lactamase (ampC) | CSB-EP360448ENV | CusabioAlternative Name(s): Cephalosporinase (ampA)Gene Names: ampCResearch Areas: MicrobiologyOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Escherichia coli Signal peptidase I (lepB), partial | CSB-EP360447ENV | CusabioAlternative Name(s): Leader peptidase IGene Names: lepBResearch Areas: MicrobiologyOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Rat Mast cell protease 2 (Mcpt2) | CSB-EP360441RA | CusabioAlternative Name(s): Group-specific protease Mast cell protease IIGene Names: Mcpt2Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Human Urokinase-type plasminogen activator (PLAU) | CSB-EP360437HU | CusabioAlternative Name(s): ATF; ATF uPA; BDPLT5; Plasminogen activator; Plasminogen activator urinary; Plasminogen activator urokinase; PLAU; QPD; u PA; U plasminogen...

Recombinant Enterobacteria phage T4 Endolysin (E) | CSB-EP360435EDZ | CusabioAlternative Name(s): Lysis protein Lysozyme MuramidaseGene Names: EResearch Areas: MicrobiologyOrganism: Enterobacteria phage T4 (Bacteriophage T4)AA Sequence:...

Recombinant Ustilago sphaerogena Ribonuclease U2 (RNU2) | CSB-EP360432UBD | CusabioAlternative Name(s): RNU2; Ribonuclease U2; RNase U2; EC 4.6.1.20Gene Names: RNU2Research Areas: OthersOrganism: Ustilago sphaerogena (Smut fungus)AA Sequence:...

Recombinant Bacillus amyloliquefaciens Ribonuclease | CSB-EP360430BQB | CusabioAlternative Name(s): /Gene Names: N/AResearch Areas: OthersOrganism: Bacillus amyloliquefaciens (Bacillus velezensis)AA Sequence:...

Recombinant Corynephage omega Diphtheria toxin, partial | CSB-EP360420CQS | CusabioAlternative Name(s): NAD(+)--diphthamide ADP-ribosyltransferaseGene Names: N/AResearch Areas: OthersOrganism: Corynephage omegaAA Sequence:...

Recombinant Enterobacter aerogenes Ribitol 2-dehydrogenase (rbtD) | CSB-EP360400EKN | CusabioAlternative Name(s): rbtD; Ribitol 2-dehydrogenase; RDH; EC 1.1.1.56Gene Names: rbtDResearch Areas: OthersOrganism: Enterobacter aerogenes (Aerobacter...

Recombinant Clostridium pasteurianum Rubredoxin | CSB-EP360387CMA | CusabioAlternative Name(s): Short name:RdGene Names: N/AResearch Areas: OthersOrganism: Clostridium pasteurianumAA Sequence: MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEESource:...

Recombinant Escherichia coli O157:H7 Stringent starvation protein B (sspB) | CSB-EP360347EOD | CusabioAlternative Name(s): sspB; Z4586; ECs4101Stringent starvation protein BGene Names: sspBResearch Areas: OthersOrganism: Escherichia coli O157:H7AA...

Recombinant Escherichia coli O6:H1 Exopolyphosphatase (ppx) | CSB-EP360285EGX | CusabioAlternative Name(s): MetaphosphataseGene Names: ppxResearch Areas: MicrobiologyOrganism: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)AA Sequence:...

Recombinant Escherichia coli Peptidyl-prolyl cis-trans isomerase A (ppiA) | CSB-EP360284EOD | CusabioAlternative Name(s): PPIase A Alternative name(s): Cyclophilin A Rotamase AGene Names: ppiAResearch Areas: ImmunologyOrganism: Escherichia coli O157:H7AA...

Recombinant Escherichia coli tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (tsaE) | CSB-EP360227ENVe1 | CusabioAlternative Name(s): t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaEGene Names: tsaEResearch Areas: Streptomyces...

Recombinant Escherichia coli tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (tsaE) | CSB-EP360227ENV | CusabioAlternative Name(s): t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaEGene Names: tsaEResearch Areas: Streptomyces...

Recombinant Escherichia coli Maltose-binding periplasmic protein (malE) | CSB-EP360183ENV | CusabioAlternative Name(s): MMBP (Maltodextrin-binding protein) (Maltose-binding protein) (MBP)Gene Names: malEResearch Areas: Tags & Cell MarkersOrganism:...

Recombinant Escherichia coli Methionine aminopeptidase (map) | CSB-EP360042ENV | CusabioAlternative Name(s): Peptidase MGene Names: mapResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Escherichia coli O6:H1 Lipopolysaccharide export system protein LptC (lptC) | CSB-EP360015EGXa2 | CusabioAlternative Name(s): lptC; c3959; Lipopolysaccharide export system protein LptCGene Names: lptCResearch Areas: OthersOrganism:...

Recombinant Escherichia coli Lipopolysaccharide export system protein lptA (lptA) | CSB-EP360010ENV | CusabioAlternative Name(s): lptA; yhbN; b3200; JW3167; Lipopolysaccharide export system protein LptAGene Names: lptAResearch Areas: OthersOrganism:...

Recombinant Escherichia coli Murein hydrolase activator NlpD (nlpD) | CSB-EP359913ENV | CusabioAlternative Name(s): nlpD; b2742; JW2712Murein hydrolase activator NlpDGene Names: nlpDResearch Areas: MicrobiologyOrganism: Escherichia coli (strain K12)AA...

Recombinant Escherichia coli Putative monooxygenase ydhR (ydhR) | CSB-EP359847ENV | CusabioAlternative Name(s): ydhR; b1667; JW1657; Putative monooxygenase YdhR; EC 1.-.-.-Gene Names: ydhRResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA...

Recombinant Streptococcus equi subsp. zooepidemicus IgG endopeptidase (ideZ) | CSB-EP3597GOM | CusabioAlternative Name(s): Gene Names: ideZResearch Areas: othersOrganism: Streptococcus equi subsp. zooepidemicusAA Sequence:...

Recombinant Escherichia coli DNA-binding protein H-NS (hns) | CSB-EP359764ENV | CusabioAlternative Name(s): Heat-stable nucleoid-structuring protein (Histone-like protein HLP-II) (Protein B1) (Protein H1) (bglY) (cur) (drdX) (hnsA) (msyA) (osmZ) (pilG)...

Recombinant Escherichia coli O157:H7 DNA-binding protein HU-alpha (hupA) | CSB-EP359761EOD | CusabioAlternative Name(s): HU-2 NS2Gene Names: hupAResearch Areas: OthersOrganism: Escherichia coli O157:H7AA Sequence:...

Recombinant Escherichia coli Chaperone surA (surA) | CSB-EP359693ENV | CusabioAlternative Name(s): Peptidyl-prolyl cis-trans isomerase SurA (EC:5.2.1.8) ;PPIase SurARotamase SurASurvival protein AGene Names: surAResearch Areas: OthersOrganism:...

Recombinant Escherichia coli Lipopolysaccharide assembly protein B (lapB), partial | CSB-EP359577ENV | CusabioAlternative Name(s): lapB; yciM; b1280; JW1272; Lipopolysaccharide assembly protein B; Lipopolysaccharide regulatory proteinGene Names:...

Recombinant Escherichia coli 3-oxoacyl-[acyl-carrier-protein] synthase 2 (fabF) | CSB-EP359466ENV | CusabioAlternative Name(s): 3-oxoacyl-[acyl-carrier-protein] synthase IIBeta-ketoacyl-ACP synthase II ;KAS IIGene Names: fabFResearch Areas:...

Recombinant Escherichia coli Thioredoxin-1 (trxA) | CSB-EP359388ENV | CusabioAlternative Name(s): trxA; fipA; tsnC; b3781; JW5856; Thioredoxin 1; Trx-1Gene Names: trxAResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Salmonella enteritidis Cold shock protein CspA (cspA) | CSB-EP359368SBG | CusabioAlternative Name(s): 7.4 kDa cold shock protein CS7.4Gene Names: cspAResearch Areas: TranscriptionOrganism: Salmonella enteritidisAA Sequence:...

Recombinant Escherichia coli O157:H7 Cell division protein FtsZ (ftsZ) | CSB-EP359271EOD | CusabioAlternative Name(s): Cell division protein FtsZGene Names: ftsZResearch Areas: OthersOrganism: Escherichia coli O157:H7AA Sequence:...

Recombinant Escherichia coli O6:H1 Cell division protein FtsZ (ftsZ) | CSB-EP359270EGX | CusabioAlternative Name(s): ftsZ; c0113Cell division protein FtsZGene Names: ftsZResearch Areas: OthersOrganism: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928...

Recombinant Escherichia coli Glutamate-pyruvate aminotransferase AlaA (alaA) | CSB-EP359250ENV | CusabioAlternative Name(s): alaA; yfbQ; b2290; JW2287Glutamate-pyruvate aminotransferase AlaA; EC 2.6.1.2Gene Names: alaAResearch Areas: OthersOrganism:...

Recombinant Escherichia coli KHG/KDPG aldolase (eda) | CSB-EP359248ENV | CusabioAlternative Name(s): 2-keto-4-hydroxyglutarate aldolase ;KHG-aldolase2-dehydro-3-deoxy-phosphogluconate aldolase (EC:4.1.2.14) ;2-keto-3-deoxy-6-phosphogluconate aldolase...

Recombinant Escherichia coli 3-oxoacyl-[acyl-carrier-protein] synthase 1 (fabB) | CSB-EP359247ENVa1 | CusabioAlternative Name(s): 3-oxoacyl-[acyl-carrier-protein] synthase I Beta-ketoacyl-ACP synthase IGene Names: fabBResearch Areas: OthersOrganism:...

Recombinant Escherichia coli 3-oxoacyl-[acyl-carrier-protein] synthase 1 (fabB) | CSB-EP359247ENV | CusabioAlternative Name(s): 3-oxoacyl-[acyl-carrier-protein] synthase I Beta-ketoacyl-ACP synthase IGene Names: fabBResearch Areas: OthersOrganism:...

Recombinant Escherichia coli O157:H7 Outer membrane protein X (ompX) | CSB-EP359230EOD | CusabioAlternative Name(s): ompX; Z1036; ECs0892; Outer membrane protein XGene Names: ompXResearch Areas: OthersOrganism: Escherichia coli O157:H7AA Sequence:...

Recombinant Escherichia coli O157:H7 Outer membrane protein A (ompA), partial | CSB-EP359226EOD | CusabioAlternative Name(s): Outer membrane protein II*Gene Names: ompAResearch Areas: OthersOrganism: Escherichia coli O157:H7AA Sequence:...

Recombinant Escherichia coli ATP-dependent Clp protease adapter protein ClpS (clpS) | CSB-EP359175ENV | CusabioAlternative Name(s): clpS; yljA; b0881; JW0865ATP-dependent Clp protease adapter protein ClpSGene Names: clpSResearch Areas: OthersOrganism:...

Recombinant Escherichia coli Transaldolase B (talB) | CSB-EP359086ENV | CusabioAlternative Name(s): yaaKGene Names: talBResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Escherichia coli Holliday junction ATP-dependent DNA helicase RuvA (ruvA) | CSB-EP359062ENV | CusabioAlternative Name(s): ruvA; b1861; JW1850; Holliday junction ATP-dependent DNA helicase RuvA; EC 3.6.4.12Gene Names: ruvAResearch Areas:...

Recombinant Escherichia coli 50S ribosomal protein L29 (rpmC) | CSB-EP358999ENVe0 | CusabioAlternative Name(s): rpmC; b3312; JW3274; 50S ribosomal protein L29; Large ribosomal subunit protein uL29Gene Names: rpmCResearch Areas: OthersOrganism:...

Recombinant Escherichia coli 50S ribosomal protein L29 (rpmC) | CSB-EP358999ENV | CusabioAlternative Name(s): rpmC; b3312; JW3274; 50S ribosomal protein L29; Large ribosomal subunit protein uL29Gene Names: rpmCResearch Areas: OthersOrganism: Escherichia...

Recombinant Escherichia coli 50S ribosomal protein L27 (rpmA) | CSB-EP358995ENVe0 | CusabioAlternative Name(s): rpmA; b3185; JW3152; 50S ribosomal protein L27; Large ribosomal subunit protein bL27Gene Names: rpmAResearch Areas: OthersOrganism:...

Recombinant Escherichia coli 50S ribosomal protein L27 (rpmA) | CSB-EP358995ENV | CusabioAlternative Name(s): rpmA; b3185; JW3152; 50S ribosomal protein L27; Large ribosomal subunit protein bL27Gene Names: rpmAResearch Areas: OthersOrganism: Escherichia...

Recombinant Escherichia coli Recombination protein RecR (recR) | CSB-EP358976ENV | CusabioAlternative Name(s): recR; b0472; JW0461; Recombination protein RecRGene Names: recRResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Escherichia coli DNA replication and repair protein RecF (recF) | CSB-EP358973ENV | CusabioAlternative Name(s): recF; uvrF; b3700; JW3677; DNA replication and repair protein RecFGene Names: recFResearch Areas: OthersOrganism: Escherichia coli...