null

Recombinant Anas platyrhynchos Lysozyme C-1 | CSB-EP360572BZD

(No reviews yet) Write a Review
SKU:
CSB-EP360572BZD
Availability:
13 - 23 Working Days
  • Recombinant Anas platyrhynchos Lysozyme C-1
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00
Frequently bought together:

Description

Recombinant Anas platyrhynchos Lysozyme C-1 | CSB-EP360572BZD | Cusabio

Alternative Name(s): 1,4-beta-N-acetylmuramidase C

Gene Names: N/A

Research Areas: Others

Organism: Anas platyrhynchos (Mallard) (Anas boschas)

AA Sequence: KVYSRCELAAAMKRLGLDNYRGYSLGNWVCAANYESGFNTQATNRNTDGSTDYGILQINSRWWCDNGKTPRSKNACGIPCSVLLRSDITEAVRCAKRIVSDGDGMNAWVAWRNRCRGTDVSKWIRGCRL

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 19-147aa

Sequence Info: Full Length of Mature Protein

MW: 30.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents.

Reference: "Chemical and immunological properties and amino acid sequences of three lysozymes from Peking-duck egg white."Kondo K., Fujio H., Amano T. J. Biochem. 91:571-587(1982)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Glycosyl hydrolase 22 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P00705

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose