Metabolism Recombinants

Recombinant Human Xaa-Pro aminopeptidase 1 (XPNPEP1) | CSB-EP878859HU | CusabioAlternative Name(s): Aminoacylproline aminopeptidaseCytosolic aminopeptidase PSoluble aminopeptidase P ;sAmpX-Pro aminopeptidase 1X-prolyl aminopeptidase 1, solubleGene Names:...

Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3) | CSB-EP875360MO | CusabioAlternative Name(s): Collagenous repeat-containing sequence 26 kDa protein Short name:CORS26 Secretory protein CORS26 Ctrp3Gene Names:...

Recombinant Mouse Sialidase-3 (Neu3) | CSB-EP872896MO | CusabioAlternative Name(s): Ganglioside sialidase (Membrane sialidase) (N-acetyl-alpha-neuraminidase 3)Gene Names: Neu3Research Areas: MetabolismOrganism: Mus musculus(Mouse)AA Sequence:...

Recombinant Human [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial (PDP2) | CSB-EP868395HU | CusabioAlternative Name(s): Pyruvate dehydrogenase phosphatase catalytic subunit 2 ;PDPC 2Gene Names: PDP2Research Areas:...

Recombinant Human Phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP) | CSB-EP867114HU | CusabioAlternative Name(s): FLJ44846; FLJ46044; HDHD2B; hLHPP; lhpp; LHPP_HUMAN; Phospholysine phosphohistidine inorganic pyrophosphate...

Recombinant Human Plasma alpha-L-fucosidase (FUCA2), partial | CSB-EP863122HU1 | CusabioAlternative Name(s): Alpha-L-fucoside fucohydrolase 2Gene Names: FUCA2Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Acetyl-CoA acetyltransferase, cytosolic (ACAT2) | CSB-EP861152HU | CusabioAlternative Name(s): Acetyl-CoA transferase-like protein Cytosolic acetoacetyl-CoA thiolaseGene Names: ACAT2Research Areas: MetabolismOrganism: Homo sapiens...

Recombinant Human Endoplasmic reticulum resident protein 44 (ERP44) | CSB-EP861125HU | CusabioAlternative Name(s): Thioredoxin domain-containing protein 4Gene Names: ERP44Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Trifunctional enzyme subunit beta, mitochondrial (Hadhb) | CSB-EP859963MO | CusabioAlternative Name(s): TP-beta ?Acetyl-CoA acyltransferase??Beta-ketothiolase?Gene Names: HadhbResearch Areas: MetabolismOrganism: Mus musculus (Mouse)AA...

Recombinant Human 17-beta-hydroxysteroid dehydrogenase 14 (HSD17B14) | CSB-EP859026HU | CusabioAlternative Name(s): 17-beta-hydroxysteroid dehydrogenase DHRS10Dehydrogenase/reductase SDR family member 10Retinal short-chain dehydrogenase/reductase...

Recombinant Human FAD synthase (FLAD1) | CSB-EP854116HU | CusabioAlternative Name(s): FAD pyrophosphorylaseFMN adenylyltransferaseFlavin adenine dinucleotide synthase 2 domains:Molybdenum cofactor biosynthesis protein-like regionFAD synthase regionGene...

Recombinant Human Probable imidazolonepropionase (AMDHD1) | CSB-EP850402HU | CusabioAlternative Name(s): Amidohydrolase domain-containing protein 1Gene Names: AMDHD1Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Galactose mutarotase (GALM) | CSB-EP850268HU | CusabioAlternative Name(s): Galactose mutarotaseGene Names: GALMResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Phosphatidylinositol-glycan biosynthesis class X protein (PIGX), partial | CSB-EP848395HU | CusabioAlternative Name(s): GPI mannosyltransferase subunit; Phosphatidylinositol glycan class X; Phosphatidylinositol-glycan biosynthesis class...

Recombinant Plasmodium falciparum Glutathione S-transferase (GST) | CSB-EP847596PLO | CusabioAlternative Name(s): PfGSTGene Names: GSTResearch Areas: MetabolismOrganism: Plasmodium falciparumAA Sequence:...

Recombinant Human Protein disulfide-isomerase TMX3 (TMX3) | CSB-EP846645HU | CusabioAlternative Name(s): Thioredoxin domain-containing protein 10Thioredoxin-related transmembrane protein 3Gene Names: TMX3Research Areas: MetabolismOrganism: Homo sapiens...

Recombinant Human Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial (SUCLG2), partial | CSB-EP846636HU | CusabioAlternative Name(s): GTP-specific succinyl-CoA synthetase subunit beta;Succinyl-CoA synthetase beta-G chain ;SCS-betaGGene Names:...

Recombinant Human Estradiol 17-beta-dehydrogenase 11 (HSD17B11) | CSB-EP843318HU | CusabioAlternative Name(s): 17-beta-hydroxysteroid dehydrogenase 11 ;17-beta-HSD 11 ;17bHSD11 ;17betaHSD1117-beta-hydroxysteroid dehydrogenase XI ;17-beta-HSD XI...

Recombinant Human D-2-hydroxyglutarate dehydrogenase, mitochondrial (D2HGDH) | CSB-EP843153HU | CusabioAlternative Name(s): D2HGDH; D2HGDD-2-hydroxyglutarate dehydrogenase; mitochondrial; EC 1.1.99.-Gene Names: D2HGDHResearch Areas: MetabolismOrganism:...

Recombinant Human Retinol dehydrogenase 12 (RDH12) | CSB-EP842727HU | CusabioAlternative Name(s): All-trans and 9-cis retinol dehydrogenase;Short chain dehydrogenase/reductase family 7C member 2Gene Names: RDH12Research Areas: MetabolismOrganism: Homo...

Recombinant Human Homogentisate 1, 2-dioxygenase (HGD) | CSB-EP842354HU | CusabioAlternative Name(s): Homogentisate oxygenase Homogentisic acid oxidase HomogentisicaseGene Names: HGDResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Nicotinamide mononucleotide adenylyltransferase 3 (NMNAT3) | CSB-EP839418HU | CusabioAlternative Name(s): Nicotinamide-nucleotide adenylyltransferase 3 ;NMN adenylyltransferase 3Nicotinate-nucleotide adenylyltransferase 3 (EC:2.7.7.18)...

Recombinant Human Polypeptide N-acetylgalactosaminyltransferase 14 (GALNT14) | CSB-EP836212HU | CusabioAlternative Name(s): Polypeptide GalNAc transferase 14 ;GalNAc-T14 ;pp-GaNTase 14Protein-UDP acetylgalactosaminyltransferase 14UDP-GalNAc:polypeptide...

Recombinant Mouse Nicotinamide riboside kinase 1 (Nrk1) | CSB-EP835569MO | CusabioAlternative Name(s): NRK 1;NmR-K 1;Nicotinic acid riboside kinase 1;Ribosylnicotinamide kinase 1;RNK 1;Ribosylnicotinic acid kinase 1Gene Names: Nrk1Research Areas:...

Recombinant Neosartorya fumigata Probable glycosidase crf1 (crf1), partial | CSB-EP818279NGS1 | CusabioAlternative Name(s): Crh-like protein 1 (Allergen: Asp f 9)Gene Names: crf1Research Areas: MetabolismOrganism: Neosartorya fumigata (strain ATCC...

Recombinant Mouse Enoyl-CoA hydratase,  mitochondrial (Echs1) (C225S) | CSB-EP804339MO(M) | CusabioAlternative Name(s): Enoyl-CoA hydratase 1 Short-chain enoyl-CoA hydrataseGene Names: Echs1Research Areas: metabolismOrganism: Mus musculus (Mouse)AA...

Recombinant Human Ragulator complex protein LAMTOR1 (LAMTOR1) | CSB-EP757083HU | CusabioAlternative Name(s): Late endosomal/lysosomal adaptor and MAPK and MTOR activator 1 Lipid raft adaptor protein p18 Protein associated with DRMs and...

Recombinant Staphylococcus aureus Chemotaxis inhibitory protein (chp) | CSB-EP746696SKV | CusabioAlternative Name(s): CHIPSGene Names: chpResearch Areas: MetabolismOrganism: Staphylococcus aureus (strain MRSA252)AA Sequence:...

Recombinant Rat Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial (Etfdh) | CSB-EP740908RA | CusabioAlternative Name(s): Electron-transferring-flavoprotein dehydrogenaseGene Names: EtfdhResearch Areas: MetabolismOrganism: Rattus...

Recombinant Rat Cytochrome P450 1B1 (Cyp1b1) | CSB-EP731067RA | CusabioAlternative Name(s): CYPIB1 Cytochrome P450RAPGene Names: Cyp1b1Research Areas: MetabolismOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Lysosomal acid lipase/cholesteryl ester hydrolase (Lipa) | CSB-EP731032RA | CusabioAlternative Name(s): Cholesteryl esterase ?Lipase A? ?Sterol esterase?Gene Names: LipaResearch Areas: MetabolismOrganism: Rattus norvegicus (Rat)AA...

Recombinant Mouse 2-oxoglutaRate dehydrogenase, mitochondrial (Ogdh), partial | CSB-EP730634MO | CusabioAlternative Name(s): 2-oxoglutarate dehydrogenase complex component E1 Short name: OGDC-E1 Alpha-ketoglutarate dehydrogenaseGene Names: OgdhResearch...

Recombinant Mouse NAD (P) H dehydrogenase [quinone] 1 (Nqo1) | CSB-EP717562MO | CusabioAlternative Name(s): Azoreductase (DT-diaphorase) (DTD) (Menadione reductase) (NAD(P)H:quinone oxidoreductase 1) (Phylloquinone reductase) (Quinone reductase 1) (QR1)...

Recombinant Mouse Alcohol dehydrogenase class 4 mu/sigma chain (Adh7) | CSB-EP717544MO | CusabioAlternative Name(s): ADH-C2 Alcohol dehydrogenase 7 Alcohol dehydrogenase class IV mu/sigma chain Gastric alcohol dehydrogenase Retinol dehydrogenaseGene...

Recombinant Mouse 5-AMP-activated protein kinase catalytic subunit alpha-1 (Prkaa1), partial | CSB-EP707843MO1 | CusabioAlternative Name(s): Acetyl-CoA carboxylase kinase (ACACA kinase) (Hydroxymethylglutaryl-CoA reductase kinase) (HMGCR kinase)...

Recombinant Staphylococcus aureus 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) | CSB-EP689073FLB | CusabioAlternative Name(s): 3-oxoacyl-[acyl-carrier-protein] synthase III;Beta-ketoacyl-ACP synthase III; KAS IIIGene Names: fabHResearch Areas:...

Recombinant Human Hereditary hemochromatosis protein (HFE), partial | CSB-EP653744HU | CusabioAlternative Name(s): HLA-HGene Names: HFEResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Escherichia coli ATP-dependent Clp protease proteolytic subunit (clpP) | CSB-EP630125EGW | CusabioAlternative Name(s): Endopeptidase ClpGene Names: clpPResearch Areas: MetabolismOrganism: Escherichia coli (strain UTI89 / UPEC)AA Sequence:...

Recombinant Human Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial (ETFDH) | CSB-EP619056HU | CusabioAlternative Name(s): Electron-transferring-flavoprotein dehydrogenase ;ETF dehydrogenaseGene Names: ETFDHResearch Areas:...

Recombinant Human Carbonic anhydrase 9 (CA9), partial | CSB-EP614990HUc0 | CusabioAlternative Name(s): Carbonate dehydratase IXCarbonic anhydrase IX ;CA-IX ;CAIXMembrane antigen MNP54/58NRenal cell carcinoma-associated antigen G250 ;R;CC-associated...

Recombinant Human Carbonic anhydrase 9 (CA9), partial | CSB-EP614990HU | CusabioAlternative Name(s): Carbonate dehydratase IXCarbonic anhydrase IX ;CA-IX ;CAIXMembrane antigen MNP54/58NRenal cell carcinoma-associated antigen G250 ;R;CC-associated antigen...

Recombinant Human Kynurenine--oxoglutarate transaminase 1 (KYAT1) | CSB-EP613699HU | CusabioAlternative Name(s): Cysteine-S-conjugate beta-lyase (EC:4.4.1.13)Glutamine transaminase K ;GTKGlutamine--phenylpyruvate transaminase (EC:2.6.1.64)Kynurenine...

Recombinant Human Peptidyl-tRNA hydrolase ICT1, mitochondrial (ICT1) | CSB-EP613490HU | CusabioAlternative Name(s): 39S ribosomal protein L58, mitochondrial ;MRP-L58Digestion substraction 1 ;DS-1Immature colon carcinoma transcript 1 proteinGene Names:...

Recombinant Bovine Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial (MTHFD2) | CSB-EP606691BO | CusabioAlternative Name(s): NAD-dependent methylenetetrahydrofolate dehydrogenase Methenyltetrahydrofolate...

Recombinant Human Peroxisomal bifunctional enzyme (EHHADH) | CSB-EP600104HU | CusabioAlternative Name(s): 3 hydroxyacyl CoA dehydrogenase; 3,2 trans enoyl CoA isomerase; 3-hydroxyacyl-CoA dehydrogenase; ECHD; ECHP_HUMAN; EHHADH; Enoyl Coenzyme A; Enoyl...

Recombinant Mouse 5-AMP-activated protein kinase subunit gamma-1 (Prkag1) | CSB-EP528783MO | CusabioAlternative Name(s): AMPK gamma1 (AMPK subunit gamma-1) (AMPKg) (Prkaac)Gene Names: Prkag1Research Areas: MetabolismOrganism: Mus musculus (Mouse)AA...

Recombinant Blattella germanica Glutathione S-transferase | CSB-EP522732BTL | CusabioAlternative Name(s): GST class-sigma Major allergen Bla g 5 Allergen: Bla g 5Gene Names: N/AResearch Areas: MetabolismOrganism: Blattella germanica (German cockroach)...

Recombinant Agaricus bisporus Polyphenol oxidase 2 (PPO2) | CSB-EP522115AYJ | CusabioAlternative Name(s): Polyphenol oxidase 2(PPO2)(Phenolase 2)(EC 1.14.18.1)(Cresolase 2)(Tyrosinase 2)Gene Names: PPO2Research Areas: MetabolismOrganism: Agaricus...

Recombinant Escherichia coli Pyruvate kinase I (pykF) | CSB-EP364920ENV | CusabioAlternative Name(s): PK-1Gene Names: pykFResearch Areas: MetabolismOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Pseudomonas aeruginosa Porin P (oprP) | CSB-EP361596EZX | CusabioAlternative Name(s): Outer membrane protein D1Gene Names: oprPResearch Areas: MetabolismOrganism: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)AA...

Recombinant Human T-cell leukemia virus 1 Envelope glycoprotein gp62 (env), partial | CSB-EP361037HQJa2 | CusabioAlternative Name(s): Env polyproteinGene Names: envResearch Areas: MetabolismOrganism: Human T-cell leukemia virus 1 (strain Japan ATK-1...

Recombinant Staphylococcus aureus Gamma-hemolysin component A (hlgA) | CSB-EP357861SUL | CusabioAlternative Name(s): H-gamma-2 (H-gamma-II) (hlg2)Gene Names: hlgAResearch Areas: MetabolismOrganism: Staphylococcus aureus (strain MW2)AA Sequence:...

Recombinant Human Purine nucleoside phosphorylase (PNP) | CSB-EP355527HU | CusabioAlternative Name(s): Inosine phosphorylaseInosine-guanosine phosphorylaseGene Names: PNPResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Trifunctional enzyme subunit beta, mitochondrial (HADHB), partial | CSB-EP347003HU1 | CusabioAlternative Name(s): TP-beta 1 domains:3-ketoacyl-CoA thiolase (EC:2.3.1.16) ;Acetyl-CoA acyltrans feraseBeta-ketothiolaseGene Names:...

Recombinant Human herpesvirus 6A Triplex capsid protein 1 (TRX1) | CSB-EP345592HJZ | CusabioAlternative Name(s): /Gene Names: TRX1Research Areas: MetabolismOrganism: Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic...

Recombinant Human Pepsin A-5 (PGA5) | CSB-EP320706HU | CusabioAlternative Name(s): Pepsinogen-5Gene Names: PGA5Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Plasmodium berghei L-lactate dehydrogenase (PB000185.00.0) | CSB-EP307560EWN | CusabioAlternative Name(s): PB000185.00.0; L-lactate dehydrogenase; EC 1.1.1.27Gene Names: PB000185.00.0Research Areas: MetabolismOrganism: Plasmodium berghei...

Recombinant Human Tyrosine--tRNA ligase, Cytoplasmic domain (YARS1) | CSB-EP026245HU | CusabioAlternative Name(s): Tyrosyl-tRNA synthetase ;TyrRSGene Names: YARS1Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Tyrosinase (TYR), partial | CSB-EP025394HU | CusabioAlternative Name(s): LB24-ABMonophenol monooxygenase;SK29-ABTumor rejection antigen ABGene Names: TYRResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Elongation factor Tu, mitochondrial (TUFM) | CSB-EP025342HU | CusabioAlternative Name(s): P43Gene Names: TUFMResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Thiopurine S-methyltransferase (TPMT), partial | CSB-EP024110HU1 | CusabioAlternative Name(s): Thiopurine methyltransferaseGene Names: TPMTResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Trimethyllysine dioxygenase, mitochondrial (TMLHE) | CSB-EP023908HU | CusabioAlternative Name(s): Epsilon-trimethyllysine 2-oxoglutarate dioxygenase;Epsilon-trimethyllysine hydroxylaseTML hydroxylaseTML-alpha-ketoglutarate dioxygenase...

Recombinant RatTryptophan 2, 3-dioxygenaseUniRule annotation (Tdo2) | CSB-EP023351RA | CusabioAlternative Name(s): Tryptamin 2,3-dioxygenase Tryptophan oxygenase Tryptophan pyrrolase TryptophanaseGene Names: Tdo2Research Areas: MetabolismOrganism: Rattus...

Recombinant Mouse Tryptophan 2, 3-dioxygenase (Tdo2) | CSB-EP023351MO | CusabioAlternative Name(s): Tryptamin 2,3-dioxygenase (Tryptophan oxygenase) (TO) (TRPO) (Tryptophan pyrrolase) (Tryptophanase) (TDO) (Tdo)Gene Names: Tdo2Research Areas:...

Recombinant Human Tryptophan 2, 3-dioxygenase (TDO2) | CSB-EP023351HUb2 | CusabioAlternative Name(s): Tryptamin 2,3-dioxygenase (Tryptophan oxygenase) (TO) (TRPO) (Tryptophan pyrrolase) (Tryptophanase) (TDO)Gene Names: TDO2Research Areas:...

Recombinant Human Tryptophan 2, 3-dioxygenase (TDO2) | CSB-EP023351HU | CusabioAlternative Name(s): Tryptamin 2,3-dioxygenase Gene Names: TDO2Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Sulfite oxidase, mitochondrial (SUOX) | CSB-EP022954HU | CusabioAlternative Name(s): EC 1.8.3.1; mitochondrial; Sulfite oxidase; Sulfite oxidase mitochondrial ; Sulfite oxidase; mitochondrial precursor; Suox; SUOX_HUMANGene Names:...

Recombinant Human Stanniocalcin-1 (STC1), partial | CSB-EP022821HU1 | CusabioAlternative Name(s): Stanniocalcin 1; Stanniocalcin; Stanniocalcin-1; STC; STC-1; Stc1; STC1_HUMANGene Names: STC1Research Areas: MetabolismOrganism: Homo sapiens (Human)AA...

Recombinant Human Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1), partial | CSB-EP021546HU | CusabioAlternative Name(s): Glucose transporter type 1, erythrocyte/brain (GLUT-1) (HepG2 glucose transporter)Gene Names:...

Recombinant Human Very long-chain acyl-CoA synthetase (SLC27A2), partial | CSB-EP021534HU | CusabioAlternative Name(s): Fatty acid transport protein 2 ;FATP-2Fatty-acid-coenzyme A ligase, very long-chain 1Long-chain-fatty-acid--CoA ligase (EC:6.2.1...

Recombinant Human Monocarboxylate transporter 5 (SLC16A4), partial | CSB-EP021411HU | CusabioAlternative Name(s): Monocarboxylate transporter 4 Solute carrier family 16 member 4Gene Names: SLC16A4Research Areas: MetabolismOrganism: Homo sapiens (Human)AA...

Recombinant Human Melanocyte protein PMEL (PMEL), partial | CSB-EP021324HU | CusabioAlternative Name(s): ME20-M ;ME20MMelanocyte protein Pmel 17Melanocytes lineage-specific antigen GP100Melanoma-associated ME20 antigen;P1;P100Premelanosome protein;Silver...

Recombinant Human Protein SCO2 homolog, mitochondrial (SCO2) | CSB-EP020853HU | CusabioAlternative Name(s): Cytochrome oxidase deficient homolog 2; MGC125823; MGC125825; OTTHUMP00000196774; OTTHUMP00000196775; Protein SCO2 homolog; mitochondrial; SCO...

Recombinant Human Diamine acetyltransferase 1 (SAT1), partial | CSB-EP020717HU1a0 | CusabioAlternative Name(s): Polyamine N-acetyltransferase 1;Putrescine acetyltransferase;Spermidine/spermine N(1)-acetyltransferase 1 ;SSAT ;SSAT-1Gene Names:...

Recombinant Human Diamine acetyltransferase 1 (SAT1), partial | CSB-EP020717HU1 | CusabioAlternative Name(s): Polyamine N-acetyltransferase 1;Putrescine acetyltransferase;Spermidine/spermine N(1)-acetyltransferase 1 ;SSAT ;SSAT-1Gene Names: SAT1Research...

Recombinant human Seryl-tRNA synthetase, Cytoplasmic domain protein (SERS), partial | CSB-EP020709HU1 | CusabioAlternative Name(s): Seryl-tRNA synthetase ;SerRSSeryl-tRNA(Ser/Sec) synthetaseGene Names: SERSResearch Areas: MetabolismOrganism: Homo sapiens...

Recombinant Human Ribokinase (RBKS), partial | CSB-EP019397HU | CusabioAlternative Name(s): RBKS; RBSK; Ribokinase; RK; EC 2.7.1.15Gene Names: RBKSResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Peptide YY (PYY), partial | CSB-EP019128HU1a0 | CusabioAlternative Name(s): PYY-IGene Names: PYY Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence: IKPEAPREDASPEELNRYYASLRHYLNLVTRQRYSource: E.coliTag Info: N-terminal...

Recombinant Human Peptide YY protein (PYY), partial | CSB-EP019128HU1 | CusabioAlternative Name(s): PYY-IGene Names: PYY Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence: IKPEAPREDASPEELNRYYASLRHYLNLVTRQRYSource: E.coliTag Info:...

Recombinant Human Glycogen phosphorylase, liver form (PYGL), partial | CSB-EP019122HU | CusabioAlternative Name(s): Glycogen phosphorylase; Glycogen phosphorylase L; Glycogen phosphorylase liver; Glycogen phosphorylase liver form; GSD6; Hers disease;...

Recombinant Human t Pyrroline-5-carboxylate reductase 1, mitochondrial (PYCR1) | CSB-EP019115HU | CusabioAlternative Name(s): /Gene Names: PYCR1Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Parvalbumin alpha (PVALB) | CSB-EP019092HU | CusabioAlternative Name(s): D22S749; MGC116759; Parvalbumin alpha; PRVA_HUMAN; PVALBGene Names: PVALBResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Prostaglandin G/H synthase 2 (PTGS2), partial | CSB-EP018986HU | CusabioAlternative Name(s): Cyclooxygenase-2 ;COX-2;PHS IIProstaglandin H2 synthase 2 ;PGH synthase 2 ;PGHS-2;Prostaglandin-endoperoxide synthase 2Gene Names:...

Recombinant Human Prostaglandin-H2 D-isomerase (PTGDS) | CSB-EP018969HU | CusabioAlternative Name(s): Beta-trace protein;Cerebrin-28Glutathione-independent PGD synthaseLipocalin-type prostaglandin-D synthaseProstaglandin-D2 synthase ;PGD2 synthase ;PGDS...

Recombinant Human Proactivator polypeptide (PSAP), partial | CSB-EP018836HU | CusabioAlternative Name(s): Proactivator polypeptideGene Names: PSAPResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Rat Anionic trypsin-1 (Prss1) | CSB-EP018811RAb0 | CusabioAlternative Name(s): Anionic trypsin I (Pretrypsinogen I) (Serine protease 1) (Try1)Gene Names: Prss1Research Areas: MetabolismOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Human Trypsin-1 (PRSS1) | CSB-EP018811HU | CusabioAlternative Name(s): Beta-trypsin (Cationic trypsinogen) (Serine protease 1) (Trypsin I) (TRP1) (TRY1) (TRYP1)Gene Names: PRSS1Research Areas: MetabolismOrganism: Homo sapiens (Human)AA...

Recombinant Human Peroxiredoxin-1 (PRDX1) | CSB-EP018653HUe0 | CusabioAlternative Name(s): Natural killer cell-enhancing factor A ;NKEF-AProliferation-associated gene protein ;PAGThioredoxin peroxidase 2Thioredoxin-dependent peroxide reductase 2Gene...

Recombinant Human Protoporphyrinogen oxidase (PPOX) | CSB-EP018502HU | CusabioAlternative Name(s): Short name: PPOGene Names: PPOXResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Phospholipase A2, membrane associated (PLA2G2A) | CSB-EP018091HU | CusabioAlternative Name(s): GIIC sPLA2Group IIA phospholipase A2Non-pancreatic secretory phospholipase A2 ;NPS-PLA2;Phosphatidylcholine 2-acylhydrolase 2AGene Names:...

Recombinant Human Pyruvate kinase isozymes R/L (PKLR) | CSB-EP018071HU | CusabioAlternative Name(s): Pyruvate kinase 1;Pyruvate kinase isozymes L/RR-type/L-type pyruvate kinaseRed cell/liver pyruvate kinaseGene Names: PKLRResearch Areas:...

Recombinant Human D-3-phosphoglycerate dehydrogenase (PHGDH), partial | CSB-EP017920HU1 | CusabioAlternative Name(s): /Gene Names: PHGDHResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Phosphoacetylglucosamine mutase (PGM3) | CSB-EP017869HU | CusabioAlternative Name(s): Acetylglucosamine phosphomutaseCuratedGene Names: PGM3Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Phosphoglucomutase-1 (PGM1) | CSB-EP017866HU | CusabioAlternative Name(s): Glucose phosphomutase 1Gene Names: PGM1Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Phosphoglycerate kinase 1 (PGK1), partial | CSB-EP017856HU1 | CusabioAlternative Name(s): Cell migration-inducing gene 10 protein;Primer recognition protein 2 ;PRP 2Gene Names: PGK1Research Areas: MetabolismOrganism: Homo sapiens...

Recombinant Mouse [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial (Pdk4), partial | CSB-EP017730MO | CusabioAlternative Name(s): Pyruvate dehydrogenase kinase isoform 4Gene Names: Pdk4Research Areas: MetabolismOrganism: Mus musculus...

Recombinant Human Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (PDHA1), partial | CSB-EP017715HUc0 | CusabioAlternative Name(s): Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial(EC 1.2.4...

Recombinant Human Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (PDHA1), partial | CSB-EP017715HUb1 | CusabioAlternative Name(s): PDHE1-A type IGene Names: PDHA1Research Areas: MetabolismOrganism: Homo sapiens (Human)AA...

Recombinant Human Phosphoenolpyruvate carboxykinase, cytosolic [GTP] (PCK1) | CSB-EP017613HU | CusabioAlternative Name(s): cytosolic [GTP]; GTP; PCK1; PCKGC_HUMAN; PEP carboxykinase; PEPCK-C; PEPCK1; PEPCKC; Phosphoenolpyruvate carboxykinase 1 (soluble);...

Recombinant Human Ornithine carbamoyltransferase, mitochondrial (OTC) | CSB-EP017270HU | CusabioAlternative Name(s): Ornithine transcarbamylase ;OTCaseGene Names: OTCResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...