- Home
- Research Recombinants
- Recombinant Human Proactivator polypeptide (PSAP), partial | CSB-EP018836HU
Cusabio Human Recombinants
Recombinant Human Proactivator polypeptide (PSAP), partial | CSB-EP018836HU
- SKU:
- CSB-EP018836HU
- UPC:
- MPN:
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Proactivator polypeptide (PSAP), partial | CSB-EP018836HU | Cusabio
Alternative Name(s): Proactivator polypeptide
Gene Names: PSAP
Research Areas: Metabolism
Organism: Homo sapiens (Human)
AA Sequence: SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGT
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 311-391aa
Sequence Info: Partial
MW: 36.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Saposin-A and saposin-C stimulate the hydrolysis of glucosylceramide by beta-glucosylceramidase (EC 3.2.1.45) and galactosylceramide by beta-galactosylceramidase (EC 3.2.1.46). Saposin-C apparently acts by combining with the enzyme and acidic lipid to form an activated complex, rather than by solubilizing the substrate.Saposin-B stimulates the hydrolysis of galacto-cerebroside sulfate by arylsulfatase A (EC 3.1.6.8), GM1 gangliosides by beta-galactosidase (EC 3.2.1.23) and globotriaosylceramide by alpha-galactosidase A (EC 3.2.1.22). Saposin-B forms a solubilizing complex with the substrates of the sphingolipid hydrolases.Saposin-D is a specific sphingomyelin phosphodiesterase activator (EC 3.1.4.12).Prosaposin: Behaves as a myelinotrophic and neurotrophic factor, these effects are mediated by its G-protein-coupled receptors, GPR37 and GPR37L1, undergoing ligand-mediated internalization followed by ERK phosphorylation signaling.
Reference: Molecular cloning of a human co-beta-glucosidase cDNA evidence that four sphingolipid hydrolase activator proteins are encoded by single genes in humans and rats.Rorman E.G., Grabowski G.A.Genomics 5:486-492(1989)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Saposin-A and saposin-C stimulate the hydrolysis of glucosylceramide by beta-glucosylceramidase (EC 3.2.1.45) and galactosylceramide by beta-galactosylceramidase (EC 3.2.1.46). Saposin-C apparently acts by combining with the enzyme and acidic lipid to form an activated complex, rather than by solubilizing the substrate.; FUNCTION
Involvement in disease: Combined saposin deficiency (CSAPD); Leukodystrophy metachromatic due to saposin-B deficiency (MLD-SAPB); Gaucher disease, atypical, due to saposin C deficiency (AGD); Krabbe disease, atypical, due to saposin A deficiency (AKRD)
Subcellular Location: Lysosome, SUBCELLULAR LOCATION: Prosaposin: Secreted
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P07602
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM
Related Products

Recombinant Human Gastric inhibitory polypeptide receptor (GIPR), partial | CSB-EP009438HU1
Cusabio Human Recombinants

Recombinant Human Islet amyloid polypeptide (IAPP), partial | CSB-EP010931HU
Cusabio Human Recombinants

Recombinant Human Neurofilament medium polypeptide (NEFM), partial | CSB-EP015691HU
Cusabio Human Recombinants

Recombinant Human Gastric inhibitory polypeptide receptor (GIPR), partial | CSB-MP009438HU1
Cusabio Human Recombinants

Recombinant Human Prosaposin (PSAP), partial | CSB-YP018836HU
Cusabio Human Recombinants
Customers Also Viewed

Recombinant Human Filaggrin (FLG) , partial | CSB-BP008712HU
Cusabio Human Recombinants

Goat Anti-Rabbit IgG(H+L) Antibody; HRP conjugated | CSB-PA564648
Cusabio Secondary Antibodies

DLG4 Antibody | CSB-PA006938LA01HU
Cusabio Polyclonal Antibodies

CD163 Antibody, HRP conjugated | CSB-PA801238LB01HU
Cusabio Polyclonal Antibodies

CD163 Antibody | CSB-PA801238LA01HU
Cusabio Polyclonal Antibodies

FKTN Antibody | CSB-PA008709LA01HU
Cusabio Polyclonal Antibodies

MPN_083 Antibody, Biotin conjugated | CSB-PA303444LD01Mlw
Cusabio Polyclonal Antibodies

MPN_083 Antibody, FITC conjugated | CSB-PA303444LC01Mlw
Cusabio Polyclonal Antibodies

LPP Antibody, FITC conjugated | CSB-PA856611LC01HU
Cusabio Polyclonal Antibodies

LPP Antibody, HRP conjugated | CSB-PA856611LB01HU
Cusabio Polyclonal Antibodies

WAS Antibody, HRP conjugated | CSB-PA025967LB01HU
Cusabio Polyclonal Antibodies

dnaK Antibody, Biotin conjugated | CSB-PA633459HD01EGW
Cusabio Polyclonal Antibodies

dnaK Antibody, FITC conjugated | CSB-PA633459HC01EGW
Cusabio Polyclonal Antibodies

dnaK Antibody | CSB-PA633459HA01EGW
Cusabio Polyclonal Antibodies

Pollen allergen Phl p 5b Antibody, FITC conjugated | CSB-PA671435HC01EUQ
Cusabio Polyclonal Antibodies

Pollen allergen Phl p 5b Antibody, HRP conjugated | CSB-PA671435HB01EUQ
Cusabio Polyclonal Antibodies

RTCB Antibody, FITC conjugated | CSB-PA897546LC01HU
Cusabio Polyclonal Antibodies

RTCB Antibody, HRP conjugated | CSB-PA897546LB01HU
Cusabio Polyclonal Antibodies

CD38 Antibody | CSB-PA004929ESR1HU
Cusabio Polyclonal Antibodies

FAP Antibody | CSB-PA614259ESR2HU
Cusabio Polyclonal Antibodies

lptA Antibody | CSB-PA360010HA01ENV
Cusabio Polyclonal Antibodies

Sialic acid-binding lectin Antibody, FITC conjugated | CSB-PA321644LC01RJL
Cusabio Polyclonal Antibodies

Pollen allergen Dac g 3 Antibody, Biotin conjugated | CSB-PA309006HD01DAC
Cusabio Polyclonal Antibodies

Pollen allergen Dac g 3 Antibody, HRP conjugated | CSB-PA309006HB01DAC
Cusabio Polyclonal Antibodies

Major pollen allergen Dac g 4 Antibody, FITC conjugated | CSB-PA307868LC01DAC
Cusabio Polyclonal Antibodies

Major pollen allergen Dac g 4 Antibody | CSB-PA307868LA01DAC
Cusabio Polyclonal Antibodies

CXCL8 Antibody, FITC conjugated | CSB-PA08327C0Rb
Cusabio Polyclonal Antibodies

MPV17 Antibody, Biotin conjugated | CSB-PA014771LD01HU
Cusabio Polyclonal Antibodies

MPV17 Antibody, FITC conjugated | CSB-PA014771LC01HU
Cusabio Polyclonal Antibodies

EYA2 Antibody | CSB-PA007907LA01HU
Cusabio Polyclonal Antibodies

Phospho-MAPT (Thr212) Antibody | CSB-PA237372
Cusabio Polyclonal Antibodies

FAP Antibody | CSB-PA101830
Cusabio Polyclonal Antibodies

LPP Antibody | CSB-PA065419
Cusabio Polyclonal Antibodies

LPP Antibody | CSB-PA994603
Cusabio Polyclonal Antibodies

DLG4 Antibody | CSB-PA575557
Cusabio Polyclonal Antibodies

FAP Antibody | CSB-PA699536
Cusabio Polyclonal Antibodies

FAP Antibody | CSB-PA949422
Cusabio Polyclonal Antibodies

FKTN Antibody | CSB-PA008709GA01HU
Cusabio Polyclonal Antibodies

EYA2 Antibody | CSB-PA007907GA01HU
Cusabio Polyclonal Antibodies

Phospho-MAPT (T534) Antibody | CSB-PA010023
Cusabio Polyclonal Antibodies

Phospho-MAPT (S356) Antibody | CSB-PA010012
Cusabio Polyclonal Antibodies

Human Fibrinogen alpha chain (FGA) ELISA kit | CSB-EL008607HU
Cusabio Elisa

Human aldehyde dehydrogenase, ALDH ELISA Kit | CSB-E11854h
Cusabio Elisa

Human Anti-Paragonimus antibody (IgM) ELISA kit | CSB-E17556h
Cusabio Elisa

Human Tubulin Beta-3 Chain (TUBB3) ELISA Kit | CSB-E14121h
Cusabio Elisa

Human Tumor necrosis factor receptor superfamily member 25 (TNFRSF25) ELISA kit | CSB-EL023980HU
Cusabio Elisa

Human soluble cluster of differentiation 146, sCD146 ELISA Kit | CSB-E11336h
Cusabio Elisa

Human Serum amyloid A-4 protein (SAA4) ELISA kit | CSB-EL020659HU
Cusabio Elisa

Human Regenerating islet-derived protein 3-gamma (REG3G) ELISA kit | CSB-EL019549HU
Cusabio Elisa

Mouse Regenerating islet-derived protein 3-alpha (REG3A) ELISA kit | CSB-EL019548MO
Cusabio Elisa