Recombinant Vaccinia virus Protein L3 (VACWR090) | CSB-YP362179VAI

(No reviews yet) Write a Review
SKU:
CSB-YP362179VAI
Availability:
25 - 35 Working Days
  • Recombinant Vaccinia virus Protein L3 (VACWR090)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$459.60 - $1,614.00

Description

Recombinant Vaccinia virus Protein L3 (VACWR090) | CSB-YP362179VAI | Cusabio

Alternative Name(s): Protein F4

Gene Names: VACWR090

Research Areas: Others

Organism: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))

AA Sequence: MNTRTDVTNDNIDKNPTKRGDKNIPGRNERFNDQNRFNNDIPKPKPRLQPNQPPKQDNKCREENGDFINIRLCAYEKEYCNDGYLSPAYYMLKQVDDEEMSCWSELSSLVRSRKAVGFPLLKAAKRISHGSMLYFEQFKNSKVVRLTPQVKCLNDTVIFQTVVILYSMYKRGIYSNEFCFDLVSIPRTNIVFSVNQLMFNICTDILVVLSICGNRLYRTNLPQSCYLNFIHGHETIARRGYEHSNYFFEWLIKNHISLLTKQTMDILKVKKKYAIGAPVNRLLEPGTLVYVPKEDYYFIGISLTDVSISDNVRVLFSTDGIVLEIEDFNIKHLFMAGEMFVRSQSSTIIV

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-350aa

Sequence Info: Full Length

MW: 42.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Might be required for transcription of early genes.

Reference: "Nucleotide sequence of a cluster of early and late genes in a conserved segment of the vaccinia virus genome."Plucienniczak A., Schroeder E., Zettlmeissl G., Streeck R.E.Nucleic Acids Res. 13:985-998(1985)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Might be required for transcription of early genes.

Involvement in disease:

Subcellular Location: Virion, Host cytoplasm

Protein Families: Poxviridae L3 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P07614

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose