Cusabio Vaccinia virus Recombinants
Recombinant Vaccinia virus Protein L3 (VACWR090) | CSB-YP362179VAI
- SKU:
- CSB-YP362179VAI
- Availability:
- 25 - 35 Working Days
Description
Recombinant Vaccinia virus Protein L3 (VACWR090) | CSB-YP362179VAI | Cusabio
Alternative Name(s): Protein F4
Gene Names: VACWR090
Research Areas: Others
Organism: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
AA Sequence: MNTRTDVTNDNIDKNPTKRGDKNIPGRNERFNDQNRFNNDIPKPKPRLQPNQPPKQDNKCREENGDFINIRLCAYEKEYCNDGYLSPAYYMLKQVDDEEMSCWSELSSLVRSRKAVGFPLLKAAKRISHGSMLYFEQFKNSKVVRLTPQVKCLNDTVIFQTVVILYSMYKRGIYSNEFCFDLVSIPRTNIVFSVNQLMFNICTDILVVLSICGNRLYRTNLPQSCYLNFIHGHETIARRGYEHSNYFFEWLIKNHISLLTKQTMDILKVKKKYAIGAPVNRLLEPGTLVYVPKEDYYFIGISLTDVSISDNVRVLFSTDGIVLEIEDFNIKHLFMAGEMFVRSQSSTIIV
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-350aa
Sequence Info: Full Length
MW: 42.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Might be required for transcription of early genes.
Reference: "Nucleotide sequence of a cluster of early and late genes in a conserved segment of the vaccinia virus genome."Plucienniczak A., Schroeder E., Zettlmeissl G., Streeck R.E.Nucleic Acids Res. 13:985-998(1985)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Might be required for transcription of early genes.
Involvement in disease:
Subcellular Location: Virion, Host cytoplasm
Protein Families: Poxviridae L3 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P07614
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: N/A
OMIM Database Link: N/A