Cusabio Vaccinia virus Recombinants
Recombinant Vaccinia virus Protein A33 (A33R), partial | CSB-BP300755VAA1
- SKU:
 - CSB-BP300755VAA1
 - Availability:
 - 3 - 7 Working Days
 
Description
Recombinant Vaccinia virus Protein A33 (A33R), partial | CSB-BP300755VAA1 | Cusabio
Alternative Name(s): A33RProtein A33
Gene Names: A33R
Research Areas: Others
Organism: Vaccinia virus (strain Copenhagen) (VACV)
AA Sequence: VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN
Source: Baculovirus
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 57-185aa
Sequence Info: Partial
MW: 18.3
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Coordinates the incorporation of A36 into intracellular enveloped virion membranes and, subsequently, the production of actin tails. Therefore plays an essential role in efficient cell-to-cell spread of viral particles
Reference: "Appendix to 'The complete DNA sequence of vaccinia virus'." Goebel S.J., Johnson G.P., Perkus M.E., Davis S.W., Winslow J.P., Paoletti E. Virology 179:517-563(1990)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P68616
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A