Cusabio Triticum aestivum Recombinants
Recombinant Triticum aestivum Glutenin, high molecular weight subunit PC237 | CSB-EP355887TQN
- SKU:
- CSB-EP355887TQN
- Availability:
- 13 - 23 Working Days
Description
Recombinant Triticum aestivum Glutenin, high molecular weight subunit PC237 | CSB-EP355887TQN | Cusabio
Alternative Name(s): Glutenin; high molecular weight subunit PC237; Fragment
Gene Names: N/A
Research Areas: Others
Organism: Triticum aestivum (Wheat)
AA Sequence: LVSVEHQAARLKVAKAQQLAAQLPAMCRLEGGDALSASQ
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-39aa
Sequence Info: Full Length
MW: 31.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Glutenins are high-molecular weight seed storage proteins of wheat endosperm. Thought to be responsible for the visco-elastic property of wheat dough.
Reference: "Identification of barley and wheat cDNA clones related to the high-M-r polypeptides of wheat gluten."Forde J., Forde B.G., Fry R.P., Kreis M., Shewry P.R., Miflin B.J.FEBS Lett. 162:360-366(1983).
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Glutenins are high-molecular weight seed storage proteins of wheat endosperm. Thought to be responsible for the visco-elastic property of wheat dough.
Involvement in disease:
Subcellular Location:
Protein Families: Gliadin/glutenin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P02862
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A