Cusabio Triticum aestivum Recombinants
Recombinant Triticum aestivum Glutenin, low molecular weight subunit 1D1 | CSB-EP319892TQN
- SKU:
- CSB-EP319892TQN
- Availability:
- 3 - 7 Working Days
Description
Recombinant Triticum aestivum Glutenin, low molecular weight subunit 1D1 | CSB-EP319892TQN | Cusabio
Alternative Name(s): Glutenin; low molecular weight subunit 1D1
Gene Names: N/A
Research Areas: Others
Organism: Triticum aestivum (Wheat)
AA Sequence: RCIPGLERPWQQQPLPPQQTFPQQPLFSQQQQQQLFPQQPSFSQQQPPFWQQQPPFSQQQPILPQQPPFSQQQQLVLPQQPPFSQQQQPVLPPQQSPFPQQQQQHQQLVQQQIPVVQPSILQQLNPCKVFLQQQCSPVAMPQRLARSQMLQQSSCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQSQQQQPQQLGQCVSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRILPTMCSVNVPLYRTTTSVPFGVGTGVGAY
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 24-307aa
Sequence Info: Full Length of Mature Protein
MW: 48.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Glutenins are high-molecular weight seed storage proteins of wheat endosperm. Thought to be responsible for the visco-elastic property of wheat dough.
Reference: "Molecular characterization of an active wheat LMW glutenin gene and its relation to other wheat and barley prolamin genes."Colot V., Bartels D., Thompson R., Flavell R.Mol. Gen. Genet. 216:81-90(1989)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Glutenins are high-molecular weight seed storage proteins of wheat endosperm. Thought to be responsible for the visco-elastic property of wheat dough.
Involvement in disease:
Subcellular Location:
Protein Families: Gliadin/glutenin family
Tissue Specificity: Expressed in endosperm, but not in husk and leaf tissues.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P10386
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A