Recombinant Triticum aestivum Glutenin, high molecular weight subunit PC237 | CSB-EP355887TQN

Recombinant Triticum aestivum Glutenin, high molecular weight subunit PC237 | CSB-EP355887TQN | Cusabio

Alternative Name(s): Glutenin; high molecular weight subunit PC237; Fragment

Gene Names: N/A

Research Areas: Others

Organism: Triticum aestivum (Wheat)

AA Sequence: LVSVEHQAARLKVAKAQQLAAQLPAMCRLEGGDALSASQ

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-39aa

Sequence Info: Full Length

MW: 31.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Glutenins are high-molecular weight seed storage proteins of wheat endosperm. Thought to be responsible for the visco-elastic property of wheat dough.

Reference: "Identification of barley and wheat cDNA clones related to the high-M-r polypeptides of wheat gluten."Forde J., Forde B.G., Fry R.P., Kreis M., Shewry P.R., Miflin B.J.FEBS Lett. 162:360-366(1983).

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Glutenins are high-molecular weight seed storage proteins of wheat endosperm. Thought to be responsible for the visco-elastic property of wheat dough.

Involvement in disease:

Subcellular Location:

Protein Families: Gliadin/glutenin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P02862

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A