Recombinant Streptomyces viridosporus Probable hydrogen peroxide-inducible genes activator (oxyR) | CSB-EP895843SNAG

(No reviews yet) Write a Review
SKU:
CSB-EP895843SNAG
Availability:
13 - 23 Working Days
$422.40 - $2,042.40

Description

Recombinant Streptomyces viridosporus Probable hydrogen peroxide-inducible genes activator (oxyR) | CSB-EP895843SNAG | Cusabio

Alternative Name(s): oxyR; Probable hydrogen peroxide-inducible genes activator

Gene Names: oxyR

Research Areas: Others

Organism: Streptomyces viridosporus

AA Sequence: MRKRRRQPSLAQLRAFAAVAEHLHFRDAAAAIGMSQPALSGAVSALEESLGVTLLERTTRKVLLSPAGERLAARAKSVLAEVGALVEEADALQAPFTGVLRLGVIPTVAPYVLPTVLRLVHDRYPRLDLQVHEEQTASLLDGLTGGRLDLLLLAVPLGVPGVVELPLFDEDFVLVTPLEHGLGGREGIPRKALRELNLLLLDEGHCLRDQALDICREAGSAGVAATTTAAGLSTLVQLVAGGLGVTLLPHTAVQVETTRSGRLLTGRFADPAPGRRIALAMRTGAARAAEYEELAAALREAMRDLPVRIVRD

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-312aa

Sequence Info: Full Length

MW: 40.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Required for the induction of a regulon of hydrogen peroxide inducible genes such as catalase and glutathione-reductase.

Reference: "Genetic organization and sequence analysis of three peroxide induced regulatory genes oxyR, ahpC and ahpX in Streptomyces viridosporus T7A, a lignocellulose degrading organism." Ramachandran S., Crawford D.L. Submitted (FEB-1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9X5P2

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose