Recombinant Streptomyces avidinii Streptavidin | CSB-EP332849SNO

(No reviews yet) Write a Review
SKU:
CSB-EP332849SNO
Availability:
13 - 23 Working Days
  • Recombinant Streptomyces avidinii Streptavidin
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Streptomyces avidinii Streptavidin | CSB-EP332849SNO | Cusabio

Alternative Name(s): ; Streptavidin

Gene Names: N/A

Research Areas: Others

Organism: Streptomyces avidinii

AA Sequence: DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 25-183aa

Sequence Info: Full Length of Mature Protein

MW: 43.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin).

Reference: Structural studies of binding site tryptophan mutants in the high-affinity streptavidin-biotin complex.Freitag S., le Trong I., Chilkoti A., Klumb L.A., Stayton P.S., Stenkamp R.E.J. Mol. Biol. 279:211-221(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin).

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Avidin/streptavidin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P22629

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose