- Home
- Research Recombinants
- Recombinant Human Insulin-induced gene 2 protein (INSIG2) | CSB-CF896742HU
Cusabio Human Recombinants
Recombinant Human Insulin-induced gene 2 protein (INSIG2) | CSB-CF896742HU
- SKU:
- CSB-CF896742HU
- UPC:
- MPN:
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Insulin-induced gene 2 protein (INSIG2) | CSB-CF896742HU | Cusabio
Alternative Name(s): Short name: INSIG-2
Gene Names: INSIG2
Research Areas: Metabolism
Organism: Homo sapiens (Human)
AA Sequence: MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE
Source: in vitro E.coli expression system
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-225aa
Sequence Info: Full Length
MW: 32.2 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance:
Reference:
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9Y5U4
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A
Related Products

Recombinant Human Progesterone-induced-blocking factor 1 (PIBF1) | CSB-CF845171HU
Cusabio Human Recombinants

Recombinant Human Calcitonin gene-related peptide 2 (CALCB) | CSB-EP004435HU
Cusabio Human Recombinants

Recombinant Human Ganglioside-induced differentiation-associated protein 2 (GDAP2) | CSB-EP868350HU
Cusabio Human Recombinants

Recombinant Rat Amphoterin-induced protein 3 (Amigo3) | CSB-MP802260RA
Cusabio Rattus norvegicus Recombinants

Recombinant Human Androgen-induced gene 1 (AIG1), partial | CSB-RP130644h
Cusabio Human Recombinants
Customers Also Viewed

Recombinant Human Androgen-induced gene 1 (AIG1), partial | CSB-RP130644h
Cusabio Human Recombinants

Recombinant Human Progesterone-induced-blocking factor 1 (PIBF1) | CSB-EP845171HU
Cusabio Human Recombinants

Recombinant Human Androgen receptor (AR), partial | CSB-EP001975HU
Cusabio Human Recombinants

Recombinant Human Stress-induced-phosphoprotein 1 (STIP1) | CSB-EP022831HU
Cusabio Human Recombinants

Recombinant Human Progesterone-induced-blocking factor 1 (PIBF1) | CSB-CF845171HU
Cusabio Human Recombinants

Recombinant Human Delta-like protein 3 (DLL3), partial | CSB-YP882142HU
Cusabio Human Recombinants

VSV-G-Tag Monoclonal Antibody | CSB-MA000161
Cusabio Tag & Control

Rabbit anti-Sheep IgG Antibody | CSB-PA00110E1Rb
Cusabio Secondary Antibodies

Rabbit anti-Chicken Yolk Immunoglobulin Antibody;FITC conjugated | CSB-PA00410G0Rb
Cusabio Secondary Antibodies

Rabbit anti-Chicken Yolk Immunoglobulin Antibody;Biotin conjugated | CSB-PA00410H0Rb
Cusabio Secondary Antibodies

Rabbit anti-Chicken Yolk Immunoglobulin Antibody | CSB-PA00410E0Rb
Cusabio Secondary Antibodies

Rabbit anti-Goat IgG Fc Antibody;Biotin conjugated | CSB-PA00570H0Rb
Cusabio Secondary Antibodies

Rabbit anti-Goat IgG Fc Antibody;HRP conjugated | CSB-PA00570F0Rb
Cusabio Secondary Antibodies

Goat Anti-Rabbit IgG(H+L) Antibody; HRP conjugated | CSB-PA564648
Cusabio Secondary Antibodies

MET Antibody | CSB-RA634199A0HU
Cusabio Recombinant Antibodies

HSF1 Antibody | CSB-RA279005A0HU
Cusabio Recombinant Antibodies

ABAT Antibody | CSB-RA242969A0HU
Cusabio Recombinant Antibodies

AKR1C3 Antibody | CSB-RA825204A0HU
Cusabio Recombinant Antibodies

RHOA Antibody | CSB-RA546523A0HU
Cusabio Recombinant Antibodies

FGFR2 Antibody | CSB-RA154582A0HU
Cusabio Recombinant Antibodies

ESR1 Antibody | CSB-RA942338A0HU
Cusabio Recombinant Antibodies

RPTOR Antibody | CSB-RA581950A0HU
Cusabio Recombinant Antibodies

CEACAM1 Antibody | CSB-RA147192A0HU
Cusabio Recombinant Antibodies

GSK3B Antibody | CSB-RA216259A0HU
Cusabio Recombinant Antibodies

SIRT1 Antibody | CSB-RA556800A0HU
Cusabio Recombinant Antibodies

NONO Antibody | CSB-RA273277A0HU
Cusabio Recombinant Antibodies

RPS6KB1 Antibody | CSB-RA299200A0HU
Cusabio Recombinant Antibodies

MAPK14 Antibody | CSB-RA582884A0HU
Cusabio Recombinant Antibodies

CDK2 Antibody | CSB-RA961467A0HU
Cusabio Recombinant Antibodies

CASP3 Antibody | CSB-RA241798A0HU
Cusabio Recombinant Antibodies

CASP3 Antibody | CSB-RA286668A0HU
Cusabio Recombinant Antibodies

CD47 Antibody | CSB-RA802124A0HU
Cusabio Recombinant Antibodies

BCHE Antibody | CSB-RA252650A0HU
Cusabio Recombinant Antibodies

CD80 Antibody | CSB-RA246383A0HU
Cusabio Recombinant Antibodies

ACLY Antibody | CSB-RA712206A0HU
Cusabio Recombinant Antibodies

ATF4 Antibody | CSB-RA002272A0HU
Cusabio Recombinant Antibodies

ARNT Antibody | CSB-RA002121A0HU
Cusabio Recombinant Antibodies

Phospho-SNCA (S129) Antibody | CSB-RA021912A129phHU
Cusabio Recombinant Antibodies

Acetyl-Histone H2B type 1-B(K20)Antibody | CSB-RA010402A20acHU
Cusabio Recombinant Antibodies

Acetyl-Histone H3.1(K56)Antibody | CSB-RA010418A56acHU
Cusabio Recombinant Antibodies

Histone H3.3 Antibody | CSB-RA010109A0HU
Cusabio Recombinant Antibodies

Phospho-Histone H1.4 (T17) Antibody | CSB-RA010380A17phHU
Cusabio Recombinant Antibodies

CD45 Antibody | CSB-RA019049A0HU
Cusabio Recombinant Antibodies

Phospho-Histone H3.3 (T3) Antibody | CSB-RA010109A03phHU
Cusabio Recombinant Antibodies

VPS26A Antibody, Biotin conjugated | CSB-PA025898LD01HU
Cusabio Polyclonal Antibodies

SUMF2 Antibody, Biotin conjugated | CSB-PA839844LD01HU
Cusabio Polyclonal Antibodies

SRC Antibody, FITC conjugated | CSB-PA022650LC11HU
Cusabio Polyclonal Antibodies

SRC Antibody, HRP conjugated | CSB-PA022650LB11HU
Cusabio Polyclonal Antibodies

SRC Antibody | CSB-PA022650LA11HU
Cusabio Polyclonal Antibodies

SRC Antibody, HRP conjugated | CSB-PA022650LB01HU
Cusabio Polyclonal Antibodies