Recombinant Salmonella typhi Universal stress protein A (uspA) | CSB-YP820596SWW

(No reviews yet) Write a Review
SKU:
CSB-YP820596SWW
Availability:
25 - 35 Working Days
  • Recombinant Salmonella typhi Universal stress protein A (uspA)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$459.60 - $1,614.00

Description

Recombinant Salmonella typhi Universal stress protein A (uspA) | CSB-YP820596SWW | Cusabio

Alternative Name(s): uspA; STY4212; t3925; Universal stress protein A

Gene Names: uspA

Research Areas: Microbiology

Organism: Salmonella typhi

AA Sequence: AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-144aa

Sequence Info: Full Length of Mature Protein

MW: 17.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Required for resistance to DNA-damaging agents.

Reference: "Comparative genomics of Salmonella enterica serovar Typhi strains Ty2 and CT18."Deng W., Liou S.-R., Plunkett G. III, Mayhew G.F., Rose D.J., Burland V., Kodoyianni V., Schwartz D.C., Blattner F.R.J. Bacteriol. 185:2330-2337(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Required for resistance to DNA-damaging agents.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Universal stress protein A family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8Z268

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose