Recombinant Salmonella typhi Universal stress protein A (uspA) | CSB-MP820596SWW

(No reviews yet) Write a Review
SKU:
CSB-MP820596SWW
Availability:
18 - 28 Working Days
  • Recombinant Salmonella typhi Universal stress protein A (uspA)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£340.00 - £808.00

Description

Recombinant Salmonella typhi Universal stress protein A (uspA) | CSB-MP820596SWW | Cusabio

Alternative Name(s): uspA; STY4212; t3925; Universal stress protein A

Gene Names: uspA

Research Areas: Microbiology

Organism: Salmonella typhi

AA Sequence: AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE

Source: Mammalian cell

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-144aa

Sequence Info: Full Length of Mature Protein

MW: 19.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Required for resistance to DNA-damaging agents.

Reference: "Complete genome sequence of a multiple drug resistant Salmonella enterica serovar Typhi CT18."Parkhill J., Dougan G., James K.D., Thomson N.R., Pickard D., Wain J., Churcher C.M., Mungall K.L., Bentley S.D., Holden M.T.G., Sebaihia M., Baker S., Basham D., Brooks K., Chillingworth T., Connerton P., Cronin A., Davis P. Barrell B.G.Nature 413:848-852(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Required for resistance to DNA-damaging agents.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Universal stress protein A family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8Z268

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose