Cusabio Saccharomyces cerevisiae Recombinants
Recombinant Saccharomyces cerevisiae Inositol phosphorylceramide synthase catalytic subunit AUR1 (AUR1), partial | CSB-EP334079SVG1
- SKU:
- CSB-EP334079SVG1
- Availability:
- 13 - 23 Working Days
Description
Recombinant Saccharomyces cerevisiae Inositol phosphorylceramide synthase catalytic subunit AUR1 (AUR1), partial | CSB-EP334079SVG1 | Cusabio
Alternative Name(s): Aureobasidin A resistance protein Phosphatidylinositol:ceramide phosphoinositol transferase
Gene Names: AUR1
Research Areas: Others
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
AA Sequence: TKYTHLPIVDTSLFCRWSYTSIEKYDISKSDPLAADSNDIESVPLSNLELDFDLNMTDEPSVSPSLFDGSTSVSRSSATSITSLGVKRA
Source: E.coli
Tag Info: N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged
Expression Region: 313-401aa
Sequence Info: Partial
MW: 26.7 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Catalytic component of the inositol phosphorylceramide synthase which catalyzes the addition of a phosphorylinositol group onto ceramide to form inositol phosphorylceramide, an essential step in sphingolipid biosynthesis.
Reference: "AUR1, a novel gene conferring aureobasidin resistance on Saccharomyces cerevisiae: a study of defective morphologies in Aur1p-depleted cells." Hashida-Okado T., Ogawa A., Endo M., Yasumoto R., Takesako K., Kato I. Mol. Gen. Genet. 251:236-244(1996)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Catalytic component of the inositol phosphorylceramide synthase which catalyzes the addition of a phosphorylinositol group onto ceramide to form inositol phosphorylceramide, an essential step in sphingolipid biosynthesis.
Involvement in disease:
Subcellular Location: Golgi apparatus, Golgi stack membrane, Multi-pass membrane protein
Protein Families: AUR1 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P36107
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A