null

Recombinant Saccharomyces cerevisiae Chitin synthase 1 (CHS1), partial | CSB-EP362292SVG

(No reviews yet) Write a Review
SKU:
CSB-EP362292SVG
Availability:
3 - 7 Working Days
  • Recombinant Saccharomyces cerevisiae Chitin synthase 1 (CHS1), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00
Frequently bought together:

Description

Recombinant Saccharomyces cerevisiae Chitin synthase 1 (CHS1), partial | CSB-EP362292SVG | Cusabio

Alternative Name(s): Chitin-UDP acetyl-glucosaminyl transferase 1

Gene Names: CHS1

Research Areas: Others

Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

AA Sequence: QNNRSRNEYHSNRKNEPSYELQNAHSGLFHSSNEELTNRNQRYTNQNASMGSFTPVQSLQFPEQSQQTNMLYNGDDGNNNTINDNERDIYGGFVNHHRQRPPPATAEYNDVFNTNSQQLPSEHQYNNVPSYPLPSINVIQTTPELIHNGSQTMATPIERPFFNENDYYYNNRNSRTSPSIASSSDGYADQEARPILE

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 4-200aa

Sequence Info: Partial

MW: 26.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Septum formation and repair, especially under certain adverse conditions.

Reference: The S. cerevisiae structural gene for chitin synthase is not required for chitin synthesis in vivo.Bulawa C.E., Slater M., Cabib E., Au-Young J., Sburlati A., Adair W.L. Jr., Robbins P.W.Cell 46:213-225(1986)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Septum formation and repair, especially under certain adverse conditions.

Involvement in disease:

Subcellular Location: Cell membrane, Multi-pass membrane protein

Protein Families: Chitin synthase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P08004

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose