Recombinant Saccharomyces cerevisiae Inositol phosphorylceramide synthase catalytic subunit AUR1 (AUR1), partial | CSB-EP334079SVG1

(No reviews yet) Write a Review
SKU:
CSB-EP334079SVG1
Availability:
13 - 23 Working Days
  • Recombinant Saccharomyces cerevisiae Inositol phosphorylceramide synthase catalytic subunit AUR1 (AUR1), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $2,042.40

Description

Recombinant Saccharomyces cerevisiae Inositol phosphorylceramide synthase catalytic subunit AUR1 (AUR1), partial | CSB-EP334079SVG1 | Cusabio

Alternative Name(s): Aureobasidin A resistance protein Phosphatidylinositol:ceramide phosphoinositol transferase

Gene Names: AUR1

Research Areas: Others

Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

AA Sequence: TKYTHLPIVDTSLFCRWSYTSIEKYDISKSDPLAADSNDIESVPLSNLELDFDLNMTDEPSVSPSLFDGSTSVSRSSATSITSLGVKRA

Source: E.coli

Tag Info: N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged

Expression Region: 313-401aa

Sequence Info: Partial

MW: 26.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Catalytic component of the inositol phosphorylceramide synthase which catalyzes the addition of a phosphorylinositol group onto ceramide to form inositol phosphorylceramide, an essential step in sphingolipid biosynthesis.

Reference: "AUR1, a novel gene conferring aureobasidin resistance on Saccharomyces cerevisiae: a study of defective morphologies in Aur1p-depleted cells." Hashida-Okado T., Ogawa A., Endo M., Yasumoto R., Takesako K., Kato I. Mol. Gen. Genet. 251:236-244(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalytic component of the inositol phosphorylceramide synthase which catalyzes the addition of a phosphorylinositol group onto ceramide to form inositol phosphorylceramide, an essential step in sphingolipid biosynthesis.

Involvement in disease:

Subcellular Location: Golgi apparatus, Golgi stack membrane, Multi-pass membrane protein

Protein Families: AUR1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P36107

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose