Cusabio Mouse Recombinants
Recombinant Mouse Lymphocyte antigen 6A-2/6E-1 (Ly6a) | CSB-EP356543MO
- SKU:
- CSB-EP356543MO
- Availability:
- 3 - 7 Working Days
Description
Recombinant Mouse Lymphocyte antigen 6A-2/6E-1 (Ly6a) | CSB-EP356543MO | Cusabio
Alternative Name(s): Ly-6A.2/Ly-6E.1;Stem cell antigen 1;SCA-1;T-cell-activating protein;TAP
Gene Names: Ly6a
Research Areas: Cardiovascular
Organism: Mus musculus (Mouse)
AA Sequence: LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNGG
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 27-112aa
Sequence Info: Full Length of Mature Protein
MW: 16.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: T-cell activation.
Reference: "Enhanced green fluorescent protein targeted to the Sca-1 (Ly-6A) locus in transgenic mice results in efficient marking of hematopoietic stem cells in vivo." Hanson P., Mathews V., Marrus S.H., Graubert T.A. Exp Hematol 31:159-167(2003)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P05533
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A