Recombinant Mouse Lymphocyte antigen 6A-2/6E-1 (Ly6a) | CSB-EP356543MO

Recombinant Mouse Lymphocyte antigen 6A-2/6E-1 (Ly6a) | CSB-EP356543MO | Cusabio

Alternative Name(s): Ly-6A.2/Ly-6E.1;Stem cell antigen 1;SCA-1;T-cell-activating protein;TAP

Gene Names: Ly6a

Research Areas: Cardiovascular

Organism: Mus musculus (Mouse)

AA Sequence: LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNGG

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 27-112aa

Sequence Info: Full Length of Mature Protein

MW: 16.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: T-cell activation.

Reference: "Enhanced green fluorescent protein targeted to the Sca-1 (Ly-6A) locus in transgenic mice results in efficient marking of hematopoietic stem cells in vivo." Hanson P., Mathews V., Marrus S.H., Graubert T.A. Exp Hematol 31:159-167(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P05533

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A