Recombinant Mouse Lymphocyte antigen 6E (Ly6e) | CSB-YP717533MO

(No reviews yet) Write a Review
SKU:
CSB-YP717533MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse Lymphocyte antigen 6E (Ly6e)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,135.00

Description

Recombinant Mouse Lymphocyte antigen 6E (Ly6e) | CSB-YP717533MO | Cusabio

Alternative Name(s): Stem cell antigen 2 Thymic shared antigen 1 Short name: TSA-1

Gene Names: Ly6e

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA

Source: Yeast

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 21-102aa

Sequence Info: Full Length of Mature Protein

MW: 24.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in T-cell development.

Reference: "Mouse stem cell antigen Sca-2 is a member of the Ly-6 family of cell surface proteins."Classon B.J., Coverdale L.Proc. Natl. Acad. Sci. U.S.A. 91:5296-5300(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in T-cell development

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q64253

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose