Recombinant Human Tumor necrosis factor receptor superfamily member 19L protein (RELT), partial | CSB-RP081794h

(No reviews yet) Write a Review
SKU:
CSB-RP081794h
Availability:
13 - 23 Working Days
  • Recombinant Human Tumor necrosis factor receptor superfamily member 19L protein (RELT), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Tumor necrosis factor receptor superfamily member 19L protein (RELT), partial | CSB-RP081794h | Cusabio

Alternative Name(s): Receptor expressed in lymphoid tissues

Gene Names: RELT

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRA

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 26-153aa

Sequence Info: Partial

MW: 17.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Mediates activation of NF-kappa-B. May play a role in T-cell activation.

Reference: RELT, a new member of the tumor necrosis factor receptor superfamily, is selectively expressed in hematopoietic tissues and activates transcription factor NF-kappaB.Sica G.L., Zhu G., Tamada K., Liu D., Ni J., Chen L.Blood 97:2702-2707(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Mediates activation of NF-kappa-B. May play a role in T-cell activation.

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type I membrane protein, Cytoplasm

Protein Families: RELT family

Tissue Specificity: Highest levels are in spleen, lymph node, thymus, peripheral blood leukocytes, bone marrow and fetal liver. Very low levels in skeletal muscle, testis and colon. Not detected in brain, kidney and pancreas.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q969Z4

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose