Cusabio Human Recombinants
Recombinant Human Trimethyllysine dioxygenase, mitochondrial (TMLHE) | CSB-EP023908HU
- SKU:
- CSB-EP023908HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Trimethyllysine dioxygenase, mitochondrial (TMLHE) | CSB-EP023908HU | Cusabio
Alternative Name(s): Epsilon-trimethyllysine 2-oxoglutarate dioxygenase;Epsilon-trimethyllysine hydroxylaseTML hydroxylaseTML-alpha-ketoglutarate dioxygenase ;TML dioxygenase ;TMLD
Gene Names: TMLHE
Research Areas: Metabolism
Organism: Homo sapiens (Human)
AA Sequence: LLKGGVIYPALPQPNFKSLLPLAVHWHHTASKSLTCAWQQHEDHFELKYANTVMRFDYVWLRDHCRSASCYNSKTHQRSLDTASVDLCIKPKTIRLDETTLFFTWPDGHVTKYDLNWLVKNSYEGQKQKVIQPRILWNAEIYQQAQVPSVDCQSFLETNEGLKKFLQNFLLYGIAFVENVPPTQEHTEKLAERISLIRETIYGRMWYFTSDFSRGDTAYTKLALDRHTDTTYFQEPCGIQVFHCLKHEGTGGRTLLVDGFYAAEQVLQKAPEEFELLSKVPLKHEYIEDVGECHNHMIGIGPVLNIYPWNKELYLIRLFKEKQNTVNRQWNSSLQCDIPERILTYRHFVSGTSIEHRGSLI
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 16-376aa
Sequence Info: Full Length of Isoform 4
MW: 46.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Converts trimethyllysine (TML) into hydroxytrimethyllysine (HTML).
Reference: Molecular and biochemical characterization of rat epsilon-N-trimethyllysine hydroxylase, the first enzyme of carnitine biosynthesis.Vaz F.M., Ofman R., Westinga K., Back J.W., Wanders R.J.A.J. Biol. Chem. 276:33512-33517(2001)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Converts trimethyllysine (TML) into hydroxytrimethyllysine (HTML)
Involvement in disease: Autism, X-linked 6 (AUTSX6)
Subcellular Location: Mitochondrion matrix
Protein Families: Gamma-BBH/TMLD family
Tissue Specificity: All isoforms, but isoform 8, are widely expressed in adult and fetal tissues. Isoform 8 is restricted to heart and skeletal muscle.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9NVH6
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM