Recombinant Human Trimethyllysine dioxygenase, mitochondrial (TMLHE) | CSB-EP023908HU

(No reviews yet) Write a Review
SKU:
CSB-EP023908HU
Availability:
13 - 23 Working Days
  • Recombinant Human Trimethyllysine dioxygenase, mitochondrial (TMLHE)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Trimethyllysine dioxygenase, mitochondrial (TMLHE) | CSB-EP023908HU | Cusabio

Alternative Name(s): Epsilon-trimethyllysine 2-oxoglutarate dioxygenase;Epsilon-trimethyllysine hydroxylaseTML hydroxylaseTML-alpha-ketoglutarate dioxygenase ;TML dioxygenase ;TMLD

Gene Names: TMLHE

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: LLKGGVIYPALPQPNFKSLLPLAVHWHHTASKSLTCAWQQHEDHFELKYANTVMRFDYVWLRDHCRSASCYNSKTHQRSLDTASVDLCIKPKTIRLDETTLFFTWPDGHVTKYDLNWLVKNSYEGQKQKVIQPRILWNAEIYQQAQVPSVDCQSFLETNEGLKKFLQNFLLYGIAFVENVPPTQEHTEKLAERISLIRETIYGRMWYFTSDFSRGDTAYTKLALDRHTDTTYFQEPCGIQVFHCLKHEGTGGRTLLVDGFYAAEQVLQKAPEEFELLSKVPLKHEYIEDVGECHNHMIGIGPVLNIYPWNKELYLIRLFKEKQNTVNRQWNSSLQCDIPERILTYRHFVSGTSIEHRGSLI

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 16-376aa

Sequence Info: Full Length of Isoform 4

MW: 46.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Converts trimethyllysine (TML) into hydroxytrimethyllysine (HTML).

Reference: Molecular and biochemical characterization of rat epsilon-N-trimethyllysine hydroxylase, the first enzyme of carnitine biosynthesis.Vaz F.M., Ofman R., Westinga K., Back J.W., Wanders R.J.A.J. Biol. Chem. 276:33512-33517(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Converts trimethyllysine (TML) into hydroxytrimethyllysine (HTML)

Involvement in disease: Autism, X-linked 6 (AUTSX6)

Subcellular Location: Mitochondrion matrix

Protein Families: Gamma-BBH/TMLD family

Tissue Specificity: All isoforms, but isoform 8, are widely expressed in adult and fetal tissues. Isoform 8 is restricted to heart and skeletal muscle.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9NVH6

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose