Recombinant Human Orexin receptor type 1 (HCRTR1) | CSB-YP010231HU1

(No reviews yet) Write a Review
SKU:
CSB-YP010231HU1
Availability:
3 - 7 Working Days
£271.20 - £1,076.00

Description

Recombinant Human Orexin receptor type 1 (HCRTR1) | CSB-YP010231HU1 | Cusabio

Alternative Name(s): Hypocretin receptor type 1

Gene Names: HCRTR1

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYE

Source: Yeast

Tag Info: N-terminal 6xHis-sumostar-tagged

Expression Region: 1-46aa

Sequence Info: Full Length

MW: 21.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca2+ levels in response to orexin-A binding

Reference: "Structure and ligand-binding mechanism of the human OX1 and OX2 orexin receptors." Yin J., Babaoglu K., Brautigam C.A., Clark L., Shao Z., Scheuermann T.H., Harrell C.M., Gotter A.L., Roecker A.J., Winrow C.J., Renger J.J., Coleman P.J., Rosenbaum D.M. Nat. Struct. Mol. Biol. 23:293-299(2016)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide

Involvement in disease:

Subcellular Location: Cell membrane, Multi-pass membrane protein

Protein Families: G-protein coupled receptor 1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O43613

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose