Recombinant Human Complement receptor type 1 (CR1), partial | CSB-EP005932HU

Recombinant Human Complement receptor type 1 (CR1), partial | CSB-EP005932HU | Cusabio

Alternative Name(s): C3b/C4b receptor CD_antigen: CD35

Gene Names: CR1

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: GQCNAPEWLPFARPTNLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCII

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 41-234aa

Sequence Info: Partial

MW: 48.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Mediates cellular binding of particles and immune complexes that have activated complement. (Microbial infection) Acts as a receptor for Epstein-Barr virus.

Reference: "Identification of distinct C3b and C4b recognition sites in the human C3b/C4b receptor (CR1, CD35) by deletion mutagenesis."Klickstein L.B., Bartow T.J., Miletic V., Rabson L.D., Smith J.A., Fearon D.T.J. Exp. Med. 168:1699-1717(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Mediates cellular binding of particles and immune complexes that have activated complement.; FUNCTION

Involvement in disease:

Subcellular Location: Membrane, Single-pass type I membrane protein

Protein Families: Receptors of complement activation (RCA) family

Tissue Specificity: Present on erythrocytes, leukocytes, glomerular podocytes, and splenic follicular dendritic cells.

Paythway: Complementandcoagulationcascades

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P17927

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM