Recombinant Human Heat shock protein beta-2 (HSPB2) | CSB-EP614956HU

(No reviews yet) Write a Review
SKU:
CSB-EP614956HU
Availability:
13 - 23 Working Days
  • Recombinant Human Heat shock protein beta-2 (HSPB2)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Heat shock protein beta-2 (HSPB2) | CSB-EP614956HU | Cusabio

Alternative Name(s): DMPK-binding protein

Gene Names: HSPB2

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-182aa

Sequence Info: Full Length

MW: 47.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May regulate the kinase DMPK.

Reference: "Identification and characterization of the gene encoding a new member of the alpha-crystallin/small hsp family, closely linked to the alphaB-crystallin gene in a head-to-head manner." Iwaki A., Nagano T., Nakagawa M., Iwaki T., Fukumaki Y. Genomics 45:386-394(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May regulate the kinase DMPK.

Involvement in disease:

Subcellular Location: Cytoplasm, Nucleus

Protein Families: Small heat shock protein (HSP20) family

Tissue Specificity: Expressed preferentially in skeletal muscle and heart but not in the lens.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q16082

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose