Recombinant Human Gamma-crystallin B (CRYGB) | CSB-EP006018HU

Recombinant Human Gamma-crystallin B (CRYGB) | CSB-EP006018HU | Cusabio

Alternative Name(s): Gamma-B-crystallin (Gamma-crystallin 1-2) (CRYG2)

Gene Names: CRYGB

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: MGKITFYEDRAFQGRSYECTTDCPNLQPYFSRCNSIRVESGCWMIYERPNYQGHQYFLRRGEYPDYQQWMGLSDSIRSCCLIPPHSGAYRMKIYDRDELRGQMSELTDDCISVQDRFHLTEIHSLNVLEGSWILYEMPNYRGRQYLLRPGEYRRFLDWGAPNAKVGSLRRVMDLY

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-175aa

Sequence Info: Full Length

MW: 24.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Crystallins are the dominant structural components of the vertebrate eye lens.

Reference: "Two human gamma-crystallin genes are linked and riddled with Alu-repeats." den Dunnen J.T., Moormann R.J.M., Cremers F.P.M., Schoenmakers J.G.G. Gene 38:197-204(1985)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Crystallins are the dominant structural components of the vertebrate eye lens.

Involvement in disease: Cataract 39, multiple types (CTRCT39)

Subcellular Location:

Protein Families: Beta/gamma-crystallin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P07316

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM