null

Recombinant Human Alpha-crystallin B chain (CRYAB) | CSB-EP006008HU

(No reviews yet) Write a Review
SKU:
CSB-EP006008HU
Availability:
3 - 7 Working Days
  • Recombinant Human Alpha-crystallin B chain (CRYAB)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00
Frequently bought together:

Description

Recombinant Human Alpha-crystallin B chain (CRYAB) | CSB-EP006008HU | Cusabio

Alternative Name(s): Alpha(B)-crystallinHeat shock protein beta-5 ;HspB5Renal carcinoma antigen NY-REN-27Rosenthal fiber component

Gene Names: CRYAB

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-175aa

Sequence Info: Full Length

MW: 36.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May contribute to the transparency and refractive index of the lens. Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions.

Reference: The primary structure of the B2 chain of human alpha-crystallin.Kramps J.A., de Man B.M., de Jong W.W.FEBS Lett. 74:82-84(1977)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May contribute to the transparency and refractive index of the lens. Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions.

Involvement in disease: Myopathy, myofibrillar, 2 (MFM2); Cataract 16, multiple types (CTRCT16); Myopathy, myofibrillar, fatal infantile hypertonic, alpha-B crystallin-related (MFMFIH-CRYAB); Cardiomyopathy, dilated 1II (CMD1II)

Subcellular Location: Cytoplasm, Nucleus

Protein Families: Small heat shock protein (HSP20) family

Tissue Specificity: Lens as well as other tissues (PubMed:838078, PubMed:2387586). Expressed in myocardial tissue (PubMed:28493373).

Paythway: Proteinprocessinginendoplasmicreticulum

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P02511

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose