Recombinant Human Beta-crystallin S (CRYGS | CSB-EP006025HU

(No reviews yet) Write a Review
SKU:
CSB-EP006025HU
Availability:
13 - 23 Working Days
  • Recombinant Human Beta-crystallin S (CRYGS
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Beta-crystallin S (CRYGS | CSB-EP006025HU | Cusabio

Alternative Name(s): Gamma-S-crystallin Gamma-crystallin S

Gene Names: CRYGS

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: SKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMREIHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 2-178aa

Sequence Info: Full Length of Mature Protein

MW: 47.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Crystallins are the dominant structural components of the vertebrate eye lens.

Reference: "The human gene for gammaS-crystallin: alternative transcripts and expressed sequences from the first intron." Wistow G., Sardarian L., Gan W., Wyatt M.K. Mol. Vis. 6:79-84(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Crystallins are the dominant structural components of the vertebrate eye lens.

Involvement in disease: Cataract 20, multiple types (CTRCT20)

Subcellular Location:

Protein Families: Beta/gamma-crystallin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P22914

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose