Recombinant Human cytomegalovirus Envelope glycoprotein L (gL) | CSB-EP515269HWW

(No reviews yet) Write a Review
SKU:
CSB-EP515269HWW
Availability:
13 - 23 Working Days
  • Recombinant Human cytomegalovirus Envelope glycoprotein L (gL)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Human cytomegalovirus Envelope glycoprotein L (gL) | CSB-EP515269HWW | Cusabio

Alternative Name(s): /

Gene Names: gL

Research Areas: Microbiology

Organism: Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)

AA Sequence: AAVSVAPTAAEKVPAECPELTRRCLLGEVFEGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLDEAFLDTLALLYNNPDQLRALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCRGYDLTRLSYGRSIFTEHVLGFELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEGITLFYGLYNAVKEFCLRHQLDPPLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVDAR

Source: E.coli

Tag Info: N-terminal 6xHis-GST-tagged

Expression Region: 31-278aa

Sequence Info: Full Length of Mature Protein

MW: 57.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL (By similarity).

Reference: "Genetic content of wild-type human cytomegalovirus."Dolan A., Cunningham C., Hector R.D., Hassan-Walker A.F., Lee L., Addison C., Dargan D.J., McGeoch D.J., Gatherer D., Emery V.C., Griffiths P.D., Sinzger C., McSharry B.P., Wilkinson G.W.G., Davison A.J.J. Gen. Virol. 85:1301-1312(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Acts as a functional inhibitor of gH and maintains gH in an inhibited form. Upon binding to host integrins, gL dissociates from gH leading to activation of the viral fusion glycoproteins gB and gH.

Involvement in disease:

Subcellular Location: Virion membrane, Peripheral membrane protein, Extracellular side, Host cell membrane, Peripheral membrane protein, Extracellular side, Host Golgi apparatus, host trans-Golgi network

Protein Families: Herpesviridae glycoprotein L family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: F5HCH8

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose