- Home
- Research Recombinants
- Recombinant Human cytomegalovirus Envelope glycoprotein B (gB), partial | CSB-EP361840HWV
Cusabio Human cytomegalovirus Recombinants
Recombinant Human cytomegalovirus Envelope glycoprotein B (gB), partial | CSB-EP361840HWV
- SKU:
- CSB-EP361840HWV
- UPC:
- MPN:
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human cytomegalovirus Envelope glycoprotein B (gB), partial | CSB-EP361840HWV | Cusabio
Alternative Name(s): /
Gene Names: gB
Research Areas: Signal Transduction
Organism: Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)
AA Sequence: TINQTSVKVLRDMNVKESPGRCYSRPVVIFNFANSSYVQYGQLGEDNEILLGNHRTEECQLPSLKIFIAGNSAYEYVDYLFKRM
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 552-635aa
Sequence Info: Partial
MW: 17.1 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Envelope glycoprotein that plays a role in host cell entry, cell to-cell virus transmission, and fusion of infected cells. May be involved in the initial attachment via binding to heparan sulfate together with the gM/gN complex that binds heparin with higher affinity. Interacts with host integrin ITGB1, PDGFRA and EGFR that likely serve as postattachment entry receptors. Participates also in the fusion of viral and cellular membranes leading to virus entry into the host cell. Membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL.
Reference: "Disulfide bond configuration of human cytomegalovirus glycoprotein B." Lopper M., Compton T. J. Virol. 76:6073-6082(2002)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P06473
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A
Related Products

Recombinant Human herpesvirus 7 Envelope glycoprotein B (gB) | CSB-CF346747HKB
Cusabio Virus & Bacteria Recombinants

Recombinant Rhesus cytomegalovirus Envelope glycoprotein B (gB), partial | CSB-EP309330RKC
Cusabio Virus & Bacteria Recombinants

Recombinant Human cytomegalovirus Envelope glycoprotein H (gH), partial | CSB-EP319015HWV
Cusabio Human cytomegalovirus Recombinants

Recombinant Human cytomegalovirus Envelope glycoprotein H (gH), partial | CSB-YP319015HWV
Cusabio Human cytomegalovirus Recombinants

Recombinant Human cytomegalovirus Envelope glycoprotein L (gL) | CSB-YP515269HWW
Cusabio Human cytomegalovirus Recombinants
Customers Also Viewed

Recombinant Human herpesvirus 1 Envelope glycoprotein B (gB), partial | CSB-MP357452HJQ
Cusabio Virus & Bacteria Recombinants

Recombinant Human herpesvirus 7 Envelope glycoprotein B (gB) | CSB-CF346747HKB
Cusabio Virus & Bacteria Recombinants

Recombinant Human herpesvirus 1 Glycoprotein C (GC), partial | CSB-EP329861HSP1
Cusabio Human herpesvirus 1 Recombinants

Recombinant Human herpesvirus 1 Envelope glycoprotein B (gB), partial | CSB-EP318023HWY
Cusabio Human herpesvirus 1 Recombinants

Recombinant Human herpesvirus 1 Envelope glycoprotein B (gB), partial | CSB-BP357452HJQ
Cusabio Human herpesvirus 1 Recombinants

Recombinant Human cytomegalovirus Envelope glycoprotein L (gL) | CSB-YP515269HWW
Cusabio Human cytomegalovirus Recombinants

Recombinant Human herpesvirus 1 Envelope glycoprotein L (gL) | CSB-EP836165HSP
Cusabio Human herpesvirus 1 Recombinants

Recombinant Human cytomegalovirus Envelope glycoprotein L (gL) | CSB-EP515269HWW
Cusabio Human cytomegalovirus Recombinants

Recombinant Human herpesvirus 6A Envelope glycoprotein B (gB), partial | CSB-EP338963HJZ
Cusabio Virus & Bacteria Recombinants

mpt64 Antibody, HRP conjugated | CSB-PA14949B0Rb
Cusabio Polyclonal Antibodies

CLTA Antibody | CSB-PA005591GA01HU
Cusabio Polyclonal Antibodies

GAPDH Monoclonal Antibody | CSB-MA000184
Cusabio Monoclonal Antibodies

Human Intestinal-type alkaline phosphatase, ALPI ELISA Kit | CSB-E09709h
Cusabio Elisa

Human myelin basic protein (MBP) antibody ELISA Kit | CSB-E04787h
Cusabio Elisa

Human anti-Endomysial antibody (EMA) (IgA) ELISA kit | CSB-E08828h
Cusabio Elisa

Human Thrombopoietin, TPO ELISA kit | CSB-E04745h
Cusabio Elisa

Human Sortilin-related receptor (SORL1) ELISA kit | CSB-EL022411HU
Cusabio Elisa

Human eosinophil granule major basic protein (EMBP/MBP) ELISA Kit | CSB-E17578h
Cusabio Elisa

Mouse Ovalbumin Specific IgG (OVA sIgG) ELISA Kit | CSB-E14990m
Cusabio Elisa

Rat myelin basic protein, MBP ELISA Kit | CSB-E08284r
Cusabio Elisa

Rat Tau Proteins ELISA kit | CSB-E13729r
Cusabio Elisa

Human Lysyl oxidase homolog 1 (LOXL1) ELISA kit | CSB-EL013040HU
Cusabio Elisa

Mouse D-Lactate Dehydrogenase, D-LDH ELISA Kit | CSB-E11723m
Cusabio Elisa

Rat lipolysaccharide binding protein, LBP ELISA Kit | CSB-E11184r
Cusabio Elisa

Mouse Lipopolysaccharide-binding protein (LBP) ELISA kit | CSB-EL012775MO
Cusabio Elisa

Human coagulation factor Ⅶ, FⅦ ELISA Kit | CSB-E12909h
Cusabio Elisa

Human coagulation factor Ⅴ (FⅤ) ELISA Kit | CSB-E14302h
Cusabio Elisa

Human Coagulation factor XI (F11) ELISA kit | CSB-EL007916HU
Cusabio Elisa

Human Dickkopf-related protein 2 (DKK2) ELISA kit | CSB-EL006921HU
Cusabio Elisa

Human cancer antigen 27-29 (CA 27-29) ELISA Kit | CSB-E13858h
Cusabio Elisa

Human Pancreatic Amylase, PAMY ELISA Kit | CSB-E09691h
Cusabio Elisa

Human Placental alkaline phosphatase, PLAP ELISA Kit | CSB-E09160h
Cusabio Elisa

Rat Agouti Related Protein, AGRP ELISA Kit | CSB-E13570r
Cusabio Elisa

Human Actin, cytoplasmic 2 (ACTG1) ELISA kit | CSB-EL001222HU
Cusabio Elisa

Human Follistatin Like Protein 1 (FSTL1) ELISA Kit | CSB-E13516h
Cusabio Elisa

Rat Thyroid-Peroxidase, TPO ELISA Kit | CSB-E08352r
Cusabio Elisa

Human Sortilin (SORT1) ELISA kit | CSB-EL022412HU
Cusabio Elisa

Rat Protein S100-A6 (S100A6) ELISA kit | CSB-EL020634RA
Cusabio Elisa

Rat Protein S100-A1 (S100A1) ELISA kit | CSB-EL020622RA
Cusabio Elisa

Mouse prostate specific antigen, PSA ELISA Kit | CSB-E08276m
Cusabio Elisa

Human periostin/osteoblast specific factor 2 (POSTN) ELISA kit | CSB-E16444h
Cusabio Elisa

Mouse Bone-specific alkaline phosphatase (BALP) ELISA kit | CSB-E11914m
Cusabio Elisa

Human Nesfatin-1 ELISA Kit | CSB-E15050h
Cusabio Elisa

Mouse myelin basic protein, MBP ELISA Kit | CSB-E08285m
Cusabio Elisa

Human Tau proteins ELISA kit | CSB-E12011h
Cusabio Elisa

Pig Immunoglobulin A, IgA ELISA Kit | CSB-E13234p
Cusabio Elisa

Rat heat shock protein 70, hSP-70 ELISA Kit | CSB-E08308r
Cusabio Elisa

Mouse Follistatin-related protein 1 (FSTL1) ELISA kit | CSB-EL009025MO
Cusabio Elisa

Rat dopamine, DA ELISA Kit | CSB-E08660r
Cusabio Elisa

Human Programmed Death Ligand-1 (PD-L1/CD274) ELISA Kit | CSB-E13644h
Cusabio Elisa