- Home
- Research Recombinants
- Recombinant Human cytomegalovirus Envelope glycoprotein H (gH), partial | CSB-EP319015HWV
Cusabio Human cytomegalovirus Recombinants
Recombinant Human cytomegalovirus Envelope glycoprotein H (gH), partial | CSB-EP319015HWV
- SKU:
- CSB-EP319015HWV
- UPC:
- MPN:
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human cytomegalovirus Envelope glycoprotein H (gH), partial | CSB-EP319015HWV | Cusabio
Alternative Name(s): gH; UL75; Envelope glycoprotein H; gH
Gene Names: gH
Research Areas: Others
Organism: Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)
AA Sequence: RYGADAASEALDPHAFHLLLNTYGRPIRFLRENTTQCTYNSSLRNSTVVRENAISFNFFQSYNQYYVFHMPRCLFAGPLAEQFLNQVDLTETLERYQQRLNTYALVSKDLASYRSFSQQLKAQDSLGQQPTTVPPPIDLSIPHVWMPPQTTPHDWKGSHTTSGLHRPHFNQT
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 24-195aa
Sequence Info: Partial
MW: 35.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma mbranes leading to virus entry into the host cell. Mbrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL . Fusion of with fibroblasts requires the additional receptor-binding protein gO, which forms a complex with gH/gL.
Reference: ErratumVarnum S.M., Streblow D.N., Monroe M.E., Smith P., Auberry K.J., Pasa-Tolic L., Wang D., Camp D.G. II, Rodland K., Wiley S., Britt W., Shenk T., Smith R.D., Nelson J.A.J. Virol. 78:13395-13395(2004)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Following initial binding to host receptor, membrane fusion is mediated by the fusion machinery composed of gB and the heterodimer gH/gL. May also be involved in the fusion between the virion envelope and the outer nuclear membrane during virion morphogenesis.
Involvement in disease:
Subcellular Location: Virion membrane, Single-pass type I membrane protein, Host cell membrane, Single-pass type I membrane protein, Host endosome membrane, Single-pass type I membrane protein
Protein Families: Herpesviridae glycoprotein H family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P12824
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A
Related Products

Recombinant Rhesus cytomegalovirus Envelope glycoprotein B (gB), partial | CSB-EP309330RKC
Cusabio Virus & Bacteria Recombinants

Recombinant Human cytomegalovirus Envelope glycoprotein B (gB), partial | CSB-EP361840HWV
Cusabio Human cytomegalovirus Recombinants

Recombinant Human cytomegalovirus Envelope glycoprotein L (gL) | CSB-EP515269HWW
Cusabio Human cytomegalovirus Recombinants

Recombinant Human cytomegalovirus Envelope glycoprotein H (gH), partial | CSB-YP319015HWV
Cusabio Human cytomegalovirus Recombinants

Recombinant Human cytomegalovirus Envelope glycoprotein L (gL) | CSB-YP515269HWW
Cusabio Human cytomegalovirus Recombinants
Customers Also Viewed

Recombinant Human cytomegalovirus Envelope glycoprotein H (gH), partial | CSB-YP319015HWV
Cusabio Human cytomegalovirus Recombinants

Recombinant Human herpesvirus 1 Envelope glycoprotein L (gL) | CSB-EP836165HSP
Cusabio Human herpesvirus 1 Recombinants

Recombinant Human cytomegalovirus Envelope glycoprotein L (gL) | CSB-YP515269HWW
Cusabio Human cytomegalovirus Recombinants

EYA2 Antibody | CSB-PA007907LA01HU
Cusabio Polyclonal Antibodies

Phospho-MAPT (Thr212) Antibody | CSB-PA237372
Cusabio Polyclonal Antibodies

EYA2 Antibody | CSB-PA007907GA01HU
Cusabio Polyclonal Antibodies

Phospho-MAPT (T534) Antibody | CSB-PA010023
Cusabio Polyclonal Antibodies

Phospho-MAPT (S356) Antibody | CSB-PA010012
Cusabio Polyclonal Antibodies

Phospho-CHEK2 (T387) Antibody | CSB-PA006787
Cusabio Polyclonal Antibodies

Rat Growth/differentiation factor 8 (MSTN) ELISA kit | CSB-EL015057RA
Cusabio Elisa

Human Follistatin-related protein 4 (FSTL4) ELISA kit | CSB-EL009027HU
Cusabio Elisa

Human Dickkopf-related protein 4 (DKK4) ELISA kit | CSB-EL006923HU
Cusabio Elisa

Human alpha-amylase (AMY1) ELISA Kit | CSB-E14075h
Cusabio Elisa

Human myelin basic protein (MBP) antibody ELISA Kit | CSB-E04787h
Cusabio Elisa

Human Regenerating islet-derived protein 3-gamma (REG3G) ELISA kit | CSB-EL019549HU
Cusabio Elisa

Mouse Regenerating islet-derived protein 3-alpha (REG3A) ELISA kit | CSB-EL019548MO
Cusabio Elisa

Human Regenerating islet-derived protein 3-alpha (REG3A) ELISA kit | CSB-EL019548HU
Cusabio Elisa

Rat Prostaglandin-H2 D-isomerase (PTGDS) ELISA kit | CSB-EL018969RA
Cusabio Elisa

Mouse D-Lactate Dehydrogenase, D-LDH ELISA Kit | CSB-E11723m
Cusabio Elisa

Human L-lactate dehydrogenase B chain (LDHB) ELISA kit | CSB-EL012841HU
Cusabio Elisa

Human glucocorticoid receptor-β, GR-β ELISA Kit | CSB-E08889h
Cusabio Elisa

Human Growth/differentiation factor 11 (GDF11) ELISA kit | CSB-EL009344HU
Cusabio Elisa

Mouse coagulation factor Ⅺ, FⅪ ELISA Kit | CSB-E17818m
Cusabio Elisa

Mouse coagulation factor Ⅶ, FⅦ ELISA Kit | CSB-E17817m
Cusabio Elisa

Rat Agouti Related Protein, AGRP ELISA Kit | CSB-E13570r
Cusabio Elisa

Human β-actin ELISA Kit | CSB-E13298h
Cusabio Elisa

Human Follistatin Like Protein 1 (FSTL1) ELISA Kit | CSB-E13516h
Cusabio Elisa

Human β-hexosaminidase A, β-Hex A ELISA Kit | CSB-E09462h
Cusabio Elisa
ELISA kit Rat extracellular superoxide dismutase [Cu-Zn](Cu/Zn-SOD/SOD3)ELISA kit](https://cdn11.bigcommerce.com/s-rvypo0hmzw/images/stencil/590x590/products/26942/34922/cusabio__81676.1638370075__85480.1638383402__27779.1641263881.jpg?c=1)
Rat extracellular superoxide dismutase [Cu-Zn] (Cu/Zn-SOD/SOD3) ELISA kit | CSB-E14981r
Cusabio Elisa
![Human Superoxide dismutase [Mn], mitochondrial (SOD2) ELISA kit Human Superoxide dismutase [Mn], mitochondrial (SOD2) ELISA kit](https://cdn11.bigcommerce.com/s-rvypo0hmzw/images/stencil/590x590/products/26937/34917/cusabio__81676.1638370075__85480.1638383402__43861.1641263878.jpg?c=1)
Human Superoxide dismutase [Mn], mitochondrial (SOD2) ELISA kit | CSB-E17064h
Cusabio Elisa

Rat Protein S100-A6 (S100A6) ELISA kit | CSB-EL020634RA
Cusabio Elisa

Rat Protein S100-A1 (S100A1) ELISA kit | CSB-EL020622RA
Cusabio Elisa

Pig Immunoglobulin A, IgA ELISA Kit | CSB-E13234p
Cusabio Elisa

Rat Interferon β, IFN-β/IFNB ELISA Kit | CSB-E04845r
Cusabio Elisa

Mouse Interferon β, IFN-β/IFNB ELISA Kit | CSB-E04945m
Cusabio Elisa

Human Interferon β, IFN-β/IFNB ELISA Kit | CSB-E09889h
Cusabio Elisa

Mouse 4-Hydroxynonenal (HNE) ELISA Kit | CSB-E13412m
Cusabio Elisa

Mouse Growth/differentiation factor 11 (GDF11) ELISA kit | CSB-EL009344MO
Cusabio Elisa

Mouse Follistatin-related protein 1 (FSTL1) ELISA kit | CSB-EL009025MO
Cusabio Elisa

Rat dopamine, DA ELISA Kit | CSB-E08660r
Cusabio Elisa

Rat Cytochrome c (CYCS) ELISA kit | CSB-EL006328RA
Cusabio Elisa

Human bone alkaline phosphatase, BALP ELISA Kit | CSB-E09033h
Cusabio Elisa

Mouse rotavirus (RV) antigen (Ag) ELISA kit | CSB-EQ027718MO
Cusabio Elisa

Mouse Dickkopf-related protein 1 (DKK1) ELISA kit | CSB-EL006920MO
Cusabio Elisa

Human Rotavirus antigen, RV Ag ELISA Kit | CSB-E05033h
Cusabio Elisa

Human Agouti Related Protein, AGRP ELISA Kit | CSB-E09299h
Cusabio Elisa

Recombinant Human Vesicle-associated membrane protein-associated protein B/C (VAPB), partial (Active) | CSB-AP005491HU
Cusabio Active Proteins

Recombinant Human Growth/differentiation factor 6 (GDF6) | CSB-AP005971HU
Cusabio Active Proteins

Prev 200905 04
JopLink

Prev 200903 Ref 03 008
JopLink