Recombinant Human Cytochrome c oxidase subunit 1 (MT-CO1), partial | CSB-EP015072HU

(No reviews yet) Write a Review
SKU:
CSB-EP015072HU
Availability:
13 - 23 Working Days
£281.60 - £1,361.60

Description

Recombinant Human Cytochrome c oxidase subunit 1 (MT-CO1), partial | CSB-EP015072HU | Cusabio

Alternative Name(s): Cytochrome c oxidase polypeptide I (COI) (COXI) (MTCO1)

Gene Names: MT-CO1

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: EAFASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS

Source: E.coli

Tag Info: N-terminal 6xHis-GST-tagged

Expression Region: 474-513aa

Sequence Info: Partial

MW: 36.3 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Reference: "Lineage-specific selection in human mtDNA: lack of polymorphisms in a segment of MTND5 gene in haplogroup J." Moilanen J.S., Finnila S., Majamaa K. Mol. Biol. Evol. 20:2132-2142(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P00395

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose