Recombinant Dog Interleukin-8 (IL8) | CSB-YP011671DO

(No reviews yet) Write a Review
SKU:
CSB-YP011671DO
Availability:
25 - 35 Working Days
  • Recombinant Dog Interleukin-8 (IL8)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£306.40 - £1,618.40

Description

Recombinant Dog Interleukin-8 (IL8) | CSB-YP011671DO | Cusabio

Alternative Name(s): C-X-C motif chemokine hemokine (C-X-C motif) ligand 8

Gene Names: IL8

Research Areas: Others

Organism: Canis lupus familiaris (Dog) (Canis familiaris)

AA Sequence: AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 23-101aa

Sequence Info: Full Length of Mature Protein

MW: 11.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.

Reference: Cloning of a canine gene homologous to the human interleukin-8-encoding gene.Ishikawa J., Suzuki S., Hotta K., Hirota Y., Mizuno S., Suzuki K.Gene 131:305-306(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Intercrine alpha (chemokine CxC) family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P41324

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose