null

Recombinant Dog Interleukin-18 (IL18) | CSB-EP895937DO

(No reviews yet) Write a Review
SKU:
CSB-EP895937DO
Availability:
3 - 7 Working Days
  • Recombinant Dog Interleukin-18 (IL18)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00
Frequently bought together:

Description

Recombinant Dog Interleukin-18 (IL18) | CSB-EP895937DO | Cusabio

Alternative Name(s): Interferon gamma-inducing factor ;IFN-gamma-inducing factorInterleukin-1 gamma ;IL-1 gamma

Gene Names: IL18

Research Areas: Others

Organism: Canis lupus familiaris (Dog) (Canis familiaris)

AA Sequence: YFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIYMYKDSLTRGLAVTISVKYKTMSTLSCKNKTISFQKMSPPDSINDEGNDIIFFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIMFTVQNKS

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 37-193aa

Sequence Info: Full Length of Mature Protein

MW: 22 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.

Reference: Cloning, sequencing, and characterization of dog interleukin-18.Argyle D.J., McGillivery C., Nicolson L., Onions D.E.Immunogenetics 49:541-543(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: IL-1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9XSR0

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose