Cusabio Canis lupus familiaris Recombinants
Recombinant Dog Interleukin-8 (IL8) | CSB-YP011671DO
- SKU:
- CSB-YP011671DO
- Availability:
- 25 - 35 Working Days
Description
Recombinant Dog Interleukin-8 (IL8) | CSB-YP011671DO | Cusabio
Alternative Name(s): C-X-C motif chemokine hemokine (C-X-C motif) ligand 8
Gene Names: IL8
Research Areas: Others
Organism: Canis lupus familiaris (Dog) (Canis familiaris)
AA Sequence: AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 23-101aa
Sequence Info: Full Length of Mature Protein
MW: 11.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
Reference: Cloning of a canine gene homologous to the human interleukin-8-encoding gene.Ishikawa J., Suzuki S., Hotta K., Hirota Y., Mizuno S., Suzuki K.Gene 131:305-306(1993)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Intercrine alpha (chemokine CxC) family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P41324
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A