Recombinant Dictyostelium discoideum Ponticulin (ponA) | CSB-EP345793DKK

Recombinant Dictyostelium discoideum Ponticulin (ponA) | CSB-EP345793DKK | Cusabio

Alternative Name(s): ponA; DDB_G0293522; Ponticulin

Gene Names: ponA

Research Areas: Microbiology

Organism: Dictyostelium discoideum (Slime mold)

AA Sequence: QYTLSVSNSASGSKCTTAVSAKLNACNTGCLNSFNIVESSNGKGLVFKTFINAACSGEYESLSQFTCAANQKIPTTSYIVSCNSTPSSNSTTDSDS

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 23-118aa

Sequence Info: Full Length of Mature Protein

MW: 13.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Binds F-actin and nucleates actin assembly. Major high affinity link between the plasma membrane and the cortical actin network.

Reference: "Identification of a second member of the ponticulin gene family and its differential expression pattern."Hitt A.L., Iijima-Shimizu M., DuBay M.J., Antonette L.L., Urushihara H., Wilkerson C.G.Biochim. Biophys. Acta 1628:79-87(2003).

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Binds F-actin and nucleates actin assembly. Major high affinity link between the plasma membrane and the cortical actin network.

Involvement in disease:

Subcellular Location: Cell membrane, Multi-pass membrane protein, Cell membrane, Lipid-anchor, GPI-anchor

Protein Families: Ponticulin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P54660

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A